Citrus Sinensis ID: 031442


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MALVSGRSTLNPNAPLFIPAAFRQVEDFSPEWWQLITTSTWYHNYWLSQHQDEDGFYDNGGDDEFDVSNVADLLPDTFDLDAGENFSSIEAQFDEFVMSFESELENISSPLPANDADALMKNMRVSISPKSSMEAAKYVEKPAKYVNPKCSPRRIQQPR
ccccccccccccccccccHHHHHHHccccHHHHHHHHccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccc
**********NPNAPLFIPAAFRQVEDFSPEWWQLITTSTWYHNYWLSQHQDEDGFYDNGGDDEFDVSNVADLLPDTFDLDAGENFSSIEAQFDEFVMS*****************DAL*********************KPAKYVNP***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALVSGRSTLNPNAPLFIPAAFRQVEDFSPEWWQLITTSTWYHNYWLSQHQDEDGFYDNGGDDEFDVSNVADLLPDTFDLDAGENFSSIEAQFDEFVMSFESELENISSPLPANDADALMKNMRVSISPKSSMEAAKYVEKPAKYVNPKCSPRRIQQPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein EARLY RESPONSIVE TO DEHYDRATION 15 Central component of stress responses that interacts with poly(A)-binding proteins. Negative regulator of abscisic acid (ABA) responses, including resistance to drought and freezing as well as stomatal closure regulation. Mediates resistance to the bacterial necrotroph pathogen Erwinia carotovora subsp. carotovora and promotes the induction of marker genes for systemic acquired resistance (SAR).probableQ39096

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
1jh4, chain Bprobable Alignment | Template Structure