Citrus Sinensis ID: 031448


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MRRWGLLAKEALTQTLTFARFFCLFHVTNHYLWSPTLVFGPSMLPTLNLTGDVILAEYVSHRVGRLGPGDIVFVRSPVDPNKIVTKRIVGVEGDRVTYFKPRNGDSCHTVVVPKGHVWIQGDNLYASRDSRQFGPVPYGLIEGKAFFRVWPPNSFGSLG
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEECcccccccccccccEEEEEEEEEcccccccccEEEECccccccccEEEEEccccccEEEEcccccccccccEECccccEEEEccccccccccccccccccccEEEEEEEEEcccccccccc
***WGLLAKEALTQTLTFARFFCLFHVTNHYLWSPTLVFGPSMLPTLNLTGDVILAEYVSHRVGRLGPGDIVFVRSPVDPNKIVTKRIVGVEGDRVTYFKPRNGDSCHTVVVPKGHVWIQGDNLYASRDSRQFGPVPYGLIEGKAFFRVWPPNSFGSLG
xxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRWGLLAKEALTQTLTFARFFCLFHVTNHYLWSPTLVFGPSMLPTLNLTGDVILAEYVSHRVGRLGPGDIVFVRSPVDPNKIVTKRIVGVEGDRVTYFKPRNGDSCHTVVVPKGHVWIQGDNLYASRDSRQFGPVPYGLIEGKAFFRVWPPNSFGSLG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial inner membrane protease subunit 1 Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space.probableO74800
Mitochondrial inner membrane protease subunit 1 Catalyzes the removal of transit peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. Known to process the nuclear encoded protein DIABLO.probableQ96LU5
Mitochondrial inner membrane protease subunit 2 Catalytic component of the mitochondrial inner membrane peptidase (IMP) complex. IMP catalyzes the removal of signal peptides required for the targeting of proteins from the mitochondrial matrix, across the inner membrane, into the inter-membrane space. The two catalytic IMP subunits seem to have non-overlapping substrate specificities. IMP2 substrates include nuclear encoded CYB2, mitochondrially encoded COX2 and cytochrome c1. Required for the stability of IMP1.probableP46972

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B12, chain A
Confidence level:very confident
Coverage over the Query: 29-153
View the alignment between query and template
View the model in PyMOL