BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031467
         (159 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3AGF|A Chain A, Crystal Structure Of Bacillus Glutaminase In The Presence
           Of 4.3m Nacl
 pdb|3AGF|B Chain B, Crystal Structure Of Bacillus Glutaminase In The Presence
           Of 4.3m Nacl
          Length = 327

 Score = 29.3 bits (64), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 23/50 (46%), Gaps = 3/50 (6%)

Query: 37  MRVVPRGTSITSTRRSVCGVGVRASVVDSYESSSN---FVKRMEQAWLIS 83
           M +VP         +S CG+G+    +D Y +S      +K M Q W +S
Sbjct: 276 MALVPPSARREQPFQSGCGIGIYGPAIDEYGNSLTGGMLLKHMAQEWELS 325


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.133    0.430 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,389,856
Number of Sequences: 62578
Number of extensions: 170938
Number of successful extensions: 255
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 254
Number of HSP's gapped (non-prelim): 4
length of query: 159
length of database: 14,973,337
effective HSP length: 91
effective length of query: 68
effective length of database: 9,278,739
effective search space: 630954252
effective search space used: 630954252
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 47 (22.7 bits)