Query         031471
Match_columns 159
No_of_seqs    68 out of 70
Neff          2.5 
Searched_HMMs 46136
Date          Fri Mar 29 14:35:03 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031471.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/031471hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03766 Remorin_N:  Remorin, N  99.7 6.1E-17 1.3E-21  112.2   4.1   53   35-90      5-57  (57)
  2 PF03763 Remorin_C:  Remorin, C  98.3 3.3E-07 7.1E-12   69.3   3.1   37   92-128     2-38  (111)
  3 PF08078 PsaX:  PsaX family;  I  91.7    0.16 3.4E-06   33.2   2.3   18  139-156    17-34  (37)
  4 PF15102 TMEM154:  TMEM154 prot  73.7     2.3   5E-05   34.5   1.9   28  130-158    58-85  (146)
  5 PF03763 Remorin_C:  Remorin, C  72.2     4.7  0.0001   30.7   3.2   29   92-120    24-52  (111)
  6 PF04277 OAD_gamma:  Oxaloaceta  69.2     7.3 0.00016   26.5   3.3   25  135-159    12-36  (79)
  7 PRK09174 F0F1 ATP synthase sub  59.4     6.1 0.00013   32.4   1.8   15  144-158    58-72  (204)
  8 PF02932 Neur_chan_memb:  Neuro  57.6      13 0.00029   25.8   2.9   23  132-154    60-82  (237)
  9 PRK10633 hypothetical protein;  53.0      16 0.00035   26.9   2.9   32  126-158    40-71  (80)
 10 PF12856 Apc9:  Anaphase-promot  51.1      11 0.00023   28.8   1.7   15   94-108    44-58  (100)
 11 PF14851 FAM176:  FAM176 family  50.9     8.6 0.00019   31.2   1.3   25  125-149    17-41  (153)
 12 PF06667 PspB:  Phage shock pro  43.8      30 0.00066   25.1   3.1   30  128-158     1-30  (75)
 13 PF05283 MGC-24:  Multi-glycosy  41.6      26 0.00056   29.2   2.7   22  133-154   162-183 (186)
 14 PF06196 DUF997:  Protein of un  41.4      33 0.00071   24.9   2.9   27  132-158    45-71  (80)
 15 PF07352 Phage_Mu_Gam:  Bacteri  40.0      59  0.0013   25.0   4.3   45   81-125    15-59  (149)
 16 PF03250 Tropomodulin:  Tropomo  37.9      40 0.00087   27.5   3.3   32   72-105    55-86  (147)
 17 PF08391 Ly49:  Ly49-like prote  34.5      19 0.00042   28.1   0.9    8  126-133   112-119 (119)
 18 TIGR01195 oadG_fam sodium pump  34.2      62  0.0014   23.3   3.4   26  134-159    14-39  (82)
 19 PF06643 DUF1158:  Protein of u  32.5      24 0.00053   26.5   1.1   32  127-159    46-77  (82)
 20 PF02453 Reticulon:  Reticulon;  30.9      19 0.00041   26.6   0.3   45  111-155    93-137 (169)
 21 KOG4433 Tweety transmembrane/c  30.1      58  0.0013   31.4   3.4   24  134-157    45-68  (526)
 22 KOG4684 Uncharacterized conser  29.3      30 0.00064   30.7   1.3   31  115-145   195-225 (275)
 23 PF03929 PepSY_TM:  PepSY-assoc  29.0      95  0.0021   18.5   3.1   19  133-151     7-25  (27)
 24 PF06459 RR_TM4-6:  Ryanodine R  28.5      63  0.0014   28.2   3.2   12  143-154   180-191 (274)
 25 KOG1725 Protein involved in me  26.6      89  0.0019   26.2   3.6   40  117-156    24-66  (186)
 26 PF08513 LisH:  LisH;  InterPro  26.0      53  0.0011   19.1   1.6   11  147-157     3-13  (27)
 27 PF10577 UPF0560:  Uncharacteri  25.8      53  0.0012   33.1   2.5   26  133-158   273-299 (807)
 28 PF08928 DUF1910:  Domain of un  25.6      58  0.0012   23.5   2.1   21  123-144    83-103 (117)
 29 smart00667 LisH Lissencephaly   24.8      56  0.0012   17.7   1.5   13  146-158     5-17  (34)
 30 PF05568 ASFV_J13L:  African sw  24.7      71  0.0015   27.0   2.7   20  138-157    34-53  (189)
 31 PRK02251 putative septation in  24.1      83  0.0018   23.6   2.7   19  138-156    37-55  (87)
 32 PRK00159 putative septation in  23.7      86  0.0019   23.6   2.7   19  138-156    36-54  (87)
 33 COG3924 Predicted membrane pro  23.5      43 0.00093   25.1   1.1   19  141-159    49-67  (80)
 34 PF05933 Fun_ATP-synt_8:  Funga  22.2 1.1E+02  0.0023   20.9   2.7   21  132-152     7-27  (48)
 35 PF06781 UPF0233:  Uncharacteri  22.0      84  0.0018   23.4   2.4   28  128-157    28-55  (87)

No 1  
>PF03766 Remorin_N:  Remorin, N-terminal region ;  InterPro: IPR005518 Remorin binds both simple and complex galaturonides. The N-terminal region of remorin is proline rich, while the C-terminal region has been predicted to form a coiled-coil, that is expected to interact with other macromolecules, most likely DNA. Functional similarities between the behavior of the proteins and viral proteins involved in intercellular communication have been noted [].
Probab=99.66  E-value=6.1e-17  Score=112.19  Aligned_cols=53  Identities=62%  Similarity=0.965  Sum_probs=46.5

Q ss_pred             CCccccCCCCCCCCCCCCCccCcceeeeecCCCCCCCCCCCCCCCchhHHHHHHHH
Q 031471           35 KDVADDKTVIPSPPAEDKPEESKALAVVDKAPEAEPPAGEKSTEGSVNRDAVLARV   90 (159)
Q Consensus        35 kdVaEEKaviP~P~~e~~~ddSKAlvvVek~~~~~~~~~~k~~~gs~dRDa~LArV   90 (159)
                      +|++++|+++|||. +++.||||||++|+|..+.  ++.+|+++||+|||++||||
T Consensus         5 ~dva~ek~~~PpP~-~~k~ddSKAl~vVek~~~e--pa~eK~s~GS~dRDa~LA~v   57 (57)
T PF03766_consen    5 KDVAEEKSVIPPPA-EEKPDDSKALVVVEKKVPE--PAEEKPSEGSIDRDAALARV   57 (57)
T ss_pred             hhhccccCCCCCCC-CCCCCccceEEEeeccCCC--ccccccCCCcchhhhhhhcC
Confidence            89999999988775 6788999999999986332  88899999999999999986


No 2  
>PF03763 Remorin_C:  Remorin, C-terminal region ;  InterPro: IPR005516 Remorin binds both simple and complex galaturonides. The N-terminal region of remorin is proline rich, while the C-terminal region has been predicted to form a coiled-coil, that is expected to interact with other macromolecules, most likely DNA. Functional similarities between the behavior of the proteins and viral proteins involved in intercellular communication have been noted [].
Probab=98.35  E-value=3.3e-07  Score=69.32  Aligned_cols=37  Identities=22%  Similarity=0.198  Sum_probs=34.5

Q ss_pred             HHHHHHHHHHHhhhhhhhHhHHHhhhhhhhhhhhcCC
Q 031471           92 TEKRISLIRAWEESEKSQAENKLRASFLEFFFFFFGL  128 (159)
Q Consensus        92 ~EKrlSlIKAWEEsEKaKaeNKa~Kkls~I~sWE~~~  128 (159)
                      .+++.+.|.|||++|++|+.||++++++.|++|||..
T Consensus         2 ~~~~~a~a~aWe~ae~aK~~~r~~ree~~I~aWEn~q   38 (111)
T PF03763_consen    2 KEEVEAKADAWEEAEKAKINNRYEREEAKIQAWENLQ   38 (111)
T ss_pred             cHHHHhHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHH
Confidence            4678999999999999999999999999999999864


No 3  
>PF08078 PsaX:  PsaX family;  InterPro: IPR012986 This family consists of the PsaX family of photosystem I (PSI) protein subunits. PSI is a large multi-subunit pigment protein complex embedded in the thylakoid membranes of green plants and cyanobacteria. PsaX is one of the 12 protein subunits found in PSI and these subunits are arranged as monomers or trimers within the membrane as shown by the structure of the trimeric complex from Synechococcus elongatus [].; PDB: 3PCQ_X 1JB0_X.
Probab=91.73  E-value=0.16  Score=33.25  Aligned_cols=18  Identities=61%  Similarity=0.827  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHhh
Q 031471          139 TLALLLLSINFLVLNYIC  156 (159)
Q Consensus       139 ~~~~~~~~~~~~~~~~~~  156 (159)
                      .-++|||.|||||--|..
T Consensus        17 ~Wa~llLaINflVAayYF   34 (37)
T PF08078_consen   17 GWALLLLAINFLVAAYYF   34 (37)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHh
Confidence            357899999999988753


No 4  
>PF15102 TMEM154:  TMEM154 protein family
Probab=73.73  E-value=2.3  Score=34.45  Aligned_cols=28  Identities=43%  Similarity=0.574  Sum_probs=21.7

Q ss_pred             eeeehhHHHHHHHHHHHHHHHHHHHhhhc
Q 031471          130 CYYYFVSCVTLALLLLSINFLVLNYICRK  158 (159)
Q Consensus       130 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  158 (159)
                      -.|+.+-.|.|+||||++-||+.-| +||
T Consensus        58 iLmIlIP~VLLvlLLl~vV~lv~~~-kRk   85 (146)
T PF15102_consen   58 ILMILIPLVLLVLLLLSVVCLVIYY-KRK   85 (146)
T ss_pred             EEEEeHHHHHHHHHHHHHHHheeEE-eec
Confidence            5667777799999999998887655 554


No 5  
>PF03763 Remorin_C:  Remorin, C-terminal region ;  InterPro: IPR005516 Remorin binds both simple and complex galaturonides. The N-terminal region of remorin is proline rich, while the C-terminal region has been predicted to form a coiled-coil, that is expected to interact with other macromolecules, most likely DNA. Functional similarities between the behavior of the proteins and viral proteins involved in intercellular communication have been noted [].
Probab=72.17  E-value=4.7  Score=30.68  Aligned_cols=29  Identities=31%  Similarity=0.459  Sum_probs=22.8

Q ss_pred             HHHHHHHHHHHhhhhhhhHhHHHhhhhhh
Q 031471           92 TEKRISLIRAWEESEKSQAENKLRASFLE  120 (159)
Q Consensus        92 ~EKrlSlIKAWEEsEKaKaeNKa~Kkls~  120 (159)
                      -++..+-|.+||..+|+|++-+-.|....
T Consensus        24 ~~ree~~I~aWEn~qkaKaea~m~k~E~k   52 (111)
T PF03763_consen   24 YEREEAKIQAWENLQKAKAEAEMRKIEEK   52 (111)
T ss_pred             HHHHHhHHHHHHHHHHHHHHHHHHHHHHH
Confidence            35668999999999999998776665443


No 6  
>PF04277 OAD_gamma:  Oxaloacetate decarboxylase, gamma chain ;  InterPro: IPR005899  This family comprises distantly related, low complexity, hydrophobic small subunits of several related sodium ion-pumping decarboxylases. These include oxaloacetate decarboxylase gamma subunit and methylmalonyl-CoA decarboxylase delta subunit [].; GO: 0008948 oxaloacetate decarboxylase activity, 0015081 sodium ion transmembrane transporter activity, 0071436 sodium ion export, 0016020 membrane
Probab=69.19  E-value=7.3  Score=26.52  Aligned_cols=25  Identities=32%  Similarity=0.517  Sum_probs=19.0

Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhhcC
Q 031471          135 VSCVTLALLLLSINFLVLNYICRKF  159 (159)
Q Consensus       135 ~~~~~~~~~~~~~~~~~~~~~~~~~  159 (159)
                      .+.|.+.|++|++-+-++.+++++|
T Consensus        12 m~iVF~~L~lL~~~i~l~~~~~~~~   36 (79)
T PF04277_consen   12 MGIVFLVLILLILVISLMSKLIRKF   36 (79)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            4667777888888888888888764


No 7  
>PRK09174 F0F1 ATP synthase subunit B'; Validated
Probab=59.44  E-value=6.1  Score=32.40  Aligned_cols=15  Identities=20%  Similarity=0.368  Sum_probs=7.4

Q ss_pred             HHHHHHHHHHHhhhc
Q 031471          144 LLSINFLVLNYICRK  158 (159)
Q Consensus       144 ~~~~~~~~~~~~~~~  158 (159)
                      .+.|||++|-+|+.|
T Consensus        58 w~~I~FliL~~lL~k   72 (204)
T PRK09174         58 WLAITFGLFYLFMSR   72 (204)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            344555555555544


No 8  
>PF02932 Neur_chan_memb:  Neurotransmitter-gated ion-channel transmembrane region ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature;  InterPro: IPR006029 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ]. Five of these ion channel receptor families have been shown to form a sequence-related superfamily:   Nicotinic acetylcholine receptor (AchR), an excitatory cation channel in vertebrates and invertebrates; in vertebrate motor endplates it is composed of alpha, beta, gamma and delta/epsilon subunits; in neurons it is composed of alpha and non-alpha (or beta) subunits []. Glycine receptor, an inhibitory chloride ion channel composed of alpha and beta subunits []. Gamma-aminobutyric acid (GABA) receptor, an inhibitory chloride ion channel; at least four types of subunits (alpha, beta, gamma and delta) are known []. Serotonin 5HT3 receptor, of which there are seven major types (5HT3-5HT7) []. Glutamate receptor, an excitatory cation channel of which at least three types have been described (kainate, N-methyl-D-aspartate (NMDA) and quisqualate) [].   These receptors possess a pentameric structure (made up of varying subunits), surrounding a central pore. All known sequences of subunits from neurotransmitter-gated ion-channels are structurally related. They are composed of a large extracellular glycosylated N-terminal ligand-binding domain, followed by three hydrophobic transmembrane regions which form the ionic channel, followed by an intracellular region of variable length. A fourth hydrophobic region is found at the C-terminal of the sequence [, ]. This domain represents four transmembrane helices of a variety of neurotransmitter-gated ion-channels.; GO: 0006811 ion transport, 0016020 membrane; PDB: 1DXZ_A 3MRA_A 1EQ8_C 1OED_C 2PR9_P 1A11_A 1CEK_A 2BG9_E 2KSR_A 2K59_B ....
Probab=57.64  E-value=13  Score=25.76  Aligned_cols=23  Identities=22%  Similarity=0.413  Sum_probs=11.6

Q ss_pred             eehhHHHHHHHHHHHHHHHHHHH
Q 031471          132 YYFVSCVTLALLLLSINFLVLNY  154 (159)
Q Consensus       132 ~~~~~~~~~~~~~~~~~~~~~~~  154 (159)
                      |||+.++.+..+++.+.++++|+
T Consensus        60 ~~~~~~~~v~~~~~~~avv~~~~   82 (237)
T PF02932_consen   60 WYFICTMFVFSASLEFAVVVYNI   82 (237)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhccccchhhhHHHHhhhhhhhh
Confidence            34544455544555555555554


No 9  
>PRK10633 hypothetical protein; Provisional
Probab=53.01  E-value=16  Score=26.90  Aligned_cols=32  Identities=28%  Similarity=0.703  Sum_probs=23.8

Q ss_pred             cCCceeeehhHHHHHHHHHHHHHHHHHHHhhhc
Q 031471          126 FGLNCYYYFVSCVTLALLLLSINFLVLNYICRK  158 (159)
Q Consensus       126 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  158 (159)
                      .||.. ++|.||+.+-+++..+-+++++++-|.
T Consensus        40 ~GlP~-WF~~sCi~~p~lfi~l~~~~Vk~vFkD   71 (80)
T PRK10633         40 TGLPH-WFEMACLLLPLLFILLCWLMVKFIFRD   71 (80)
T ss_pred             cCCcH-HHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            44443 467899998888888888888887664


No 10 
>PF12856 Apc9:  Anaphase-promoting complex subunit 9;  InterPro: IPR024274  The anaphase-promoting complex (APC) or cyclosome is a multi-subunit E3 protein ubiquitin ligase that regulates important events in mitosis such as the initiation of anaphase and exit from telophase. The APC, in conjunction with other enzymes, assembles multi-ubiquitin chains on a variety of regulatory proteins, thereby targeting them for proteolysis by the 26S proteasome. Anaphase is initiated when the APC triggers the destruction of securin, thereby allowing the protease, separase, to disrupt sister-chromatid cohesion. Securin ubiquitination by the APC is inhibited by cyclin-dependent kinase 1 (Cdk1)-dependent phosphorylation []. Forkhead Box M1 (FoxM1), which is a transcription factor that is over-expressed in many cancers, is degraded in late mitosis and early G1 phase by the APC/cyclosome (APC/C) E3 ubiquitin ligase []. The APC/C targets mitotic cyclins for destruction in mitosis and G1 phase and is then inactivated at S phase. It thereby generates alternating states of high and low cyclin-Cdk activity, which is required for the alternation of mitosis and DNA replication []. The APC/C is composed of at least 13 subunits that stay tightly associated throughout the cell cycle: APC1, APC2, APC4, APC5, APC9, APC11, CDC16, CDC23, CDC26, CDC27, DOC1, MND2 and SWM1[], []. In fission yeast the 13 subunits are known as: Apc1, Apc2, Nuc2, Apc4, Apc5, Cut9, Apc8, Apc10, Apc11, Hcn1, Apc13, Apc14 and Apc15 []. All APC subunits are members of the cullin family proteins, which bind to a ring-finger subunit via a conserved cullin domain [].The APC can be divided in four parts, the third of which is a tetratricopeptide repeat arm (TPR) that contains multiple subunits, including Apc9 []. This entry represents Apc9, one of the subunits of the anaphase-promoting complex.
Probab=51.14  E-value=11  Score=28.81  Aligned_cols=15  Identities=47%  Similarity=0.674  Sum_probs=13.6

Q ss_pred             HHHHHHHHHhhhhhh
Q 031471           94 KRISLIRAWEESEKS  108 (159)
Q Consensus        94 KrlSlIKAWEEsEKa  108 (159)
                      -|.|.|++||.+|++
T Consensus        44 l~eSkI~~~l~sEra   58 (100)
T PF12856_consen   44 LRESKIKAWLSSERA   58 (100)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            689999999999985


No 11 
>PF14851 FAM176:  FAM176 family
Probab=50.92  E-value=8.6  Score=31.16  Aligned_cols=25  Identities=32%  Similarity=0.167  Sum_probs=17.2

Q ss_pred             hcCCceeeehhHHHHHHHHHHHHHH
Q 031471          125 FFGLNCYYYFVSCVTLALLLLSINF  149 (159)
Q Consensus       125 E~~~~~~~~~~~~~~~~~~~~~~~~  149 (159)
                      .|-=..+.|||++|.++|||+..-+
T Consensus        17 ~~PE~~aLYFv~gVC~GLlLtLcll   41 (153)
T PF14851_consen   17 DNPERFALYFVSGVCAGLLLTLCLL   41 (153)
T ss_pred             hChHHHHHHHHHHHHHHHHHHHHHH
Confidence            3444457799999988887765433


No 12 
>PF06667 PspB:  Phage shock protein B;  InterPro: IPR009554 This family consists of several bacterial phage shock protein B (PspB) sequences. The phage shock protein (psp) operon is induced in response to heat, ethanol, osmotic shock and infection by filamentous bacteriophages []. Expression of the operon requires the alternative sigma factor sigma54 and the transcriptional activator PspF. In addition, PspA plays a negative regulatory role, and the integral-membrane proteins PspB and PspC play a positive one [].; GO: 0006355 regulation of transcription, DNA-dependent, 0009271 phage shock
Probab=43.82  E-value=30  Score=25.08  Aligned_cols=30  Identities=10%  Similarity=0.397  Sum_probs=20.3

Q ss_pred             CceeeehhHHHHHHHHHHHHHHHHHHHhhhc
Q 031471          128 LNCYYYFVSCVTLALLLLSINFLVLNYICRK  158 (159)
Q Consensus       128 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  158 (159)
                      |+ ++++.--+++.+++.+.-.|+|.|+-++
T Consensus         1 M~-~~fl~~plivf~ifVap~WL~lHY~sk~   30 (75)
T PF06667_consen    1 MS-FEFLFVPLIVFMIFVAPIWLILHYRSKW   30 (75)
T ss_pred             Cc-hHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            44 4444455566677778888999998653


No 13 
>PF05283 MGC-24:  Multi-glycosylated core protein 24 (MGC-24);  InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor. Its functions include mediating, or regulating, haematopoietic progenitor cell adhesion and the negative regulation of their growth and/or-differentiation. It exists in the native state as a disulphide- linked homodimer of two 80-85kDa subunits. It is usually expressed by CD34+ and CD341o/- haematopoietic stem cells and associated microenvironmental cells. It contains, in its extracellular region, two mucin domains (I and II) linked by a non-mucin domain, which has been predicted to contain intra- disulphide bridges. This receptor may play a key role in haematopoiesis by facilitating the adhesion of human CD34+ cells to bone marrow stroma and by negatively regulating CD34+ CD341o/- haematopoietic progenitor cell proliferation. These effects involve the CD164 class I and/or II epitopes recognised by the monoclonal antibodies (mAbs) 105A5 and 103B2/9E10. These epitopes are carbohydrate-dependent and are located on the N-terminal mucin domain I [, ]. It has been found that murine MGC-24v and rat endolyn share significant sequence similarities with human CD164. However, CD164 lacks the consensus glycosaminoglycan (GAG)-attachment site found in MGC-24; it is possible that GAG-association is responsible for the high molecular weight of the epithelial-derived MGC-24 glycoprotein [].  Genomic structure studies have placed CD164 within the mucin-subgroup that comprises multiple exons, and demonstrate the diverse chromosomal distribution of this family of molecules. Molecules with such multiple exons may have sophisticated regulatory mechanisms that involve not only post-translational modifications of the oligosaccharide side chains, but also differential exon usage. Although differences in the intron and exon sizes are seen between the mouse and human genes, the predicted proteins are similar in size and structure, maintaining functionally important motifs that regulate cell proliferation or subcellular distribution [].  CD164 is a gene whose expression depends on differential usage of poly- adenylation sites within the 3'-UTR. The conserved distribution of the 3.2- and 1.2-kb CD164 transcripts between mouse and human suggests that (i) a mechanism may exist to regulate tissue-specific polyadenylation, and (ii) differences in polyadenylation are important for the expression and function of CD164 in different tissues. Two other aspects of the structure of CD164 are of particular interest. First, it shares one of several conserved features of a cytokine-binding pocket - in this respect, it is notable that evidence exists for a class of cell-surface sialomucin modulators that directly interact with growth factor receptors to regulate their response to physiological ligands. Second, its cytoplasmic tail contains a C-terminal YHTL motif found in many endocytic membrane proteins or receptors. These Tyr-based motifs bind to adaptor proteins, which mediate the sorting of membrane proteins into transport vesicles from the plasma membrane to the endosomes, and between intracellular compartments. 
Probab=41.61  E-value=26  Score=29.22  Aligned_cols=22  Identities=27%  Similarity=0.587  Sum_probs=19.4

Q ss_pred             ehhHHHHHHHHHHHHHHHHHHH
Q 031471          133 YFVSCVTLALLLLSINFLVLNY  154 (159)
Q Consensus       133 ~~~~~~~~~~~~~~~~~~~~~~  154 (159)
                      -||..+.|.|.||+|-|+++.|
T Consensus       162 SFiGGIVL~LGv~aI~ff~~KF  183 (186)
T PF05283_consen  162 SFIGGIVLTLGVLAIIFFLYKF  183 (186)
T ss_pred             hhhhHHHHHHHHHHHHHHHhhh
Confidence            4889999999999999988765


No 14 
>PF06196 DUF997:  Protein of unknown function (DUF997);  InterPro: IPR010398 This is a family of predicted bacterial membrane protein with unknown function.
Probab=41.41  E-value=33  Score=24.89  Aligned_cols=27  Identities=19%  Similarity=0.709  Sum_probs=19.7

Q ss_pred             eehhHHHHHHHHHHHHHHHHHHHhhhc
Q 031471          132 YYFVSCVTLALLLLSINFLVLNYICRK  158 (159)
Q Consensus       132 ~~~~~~~~~~~~~~~~~~~~~~~~~~~  158 (159)
                      ++|.||+.+-+++..+-++++.++-+.
T Consensus        45 WF~~SCi~~~il~~~l~~~~vk~~Fkd   71 (80)
T PF06196_consen   45 WFFYSCIGGPILFIILVWLMVKFFFKD   71 (80)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            357899988777777777777776553


No 15 
>PF07352 Phage_Mu_Gam:  Bacteriophage Mu Gam like protein;  InterPro: IPR009951 The Gam protein, originally characterised in Bacteriophage Mu, protects linear double stranded DNA from exonuclease degradation in vitro and in vivo []. This protein is also found in many bacterial species as part of a suspected prophage. Further studies have shown that Gam is a functional counterpart of the eukaryotic Ku protein, which has key roles in DNA repair and in certain transposition events. Gam displays DNA binding characteristics remarkably similar to those of human Ku []. In addition, Gam can interfere with Ty1 retrotransposition in Saccharomyces cerevisiae (Baker's yeast). These data reveal structural and functional parallels between bacteriophage Gam and eukaryotic Ku and suggest that their functions have been evolutionarily conserved [].; GO: 0003690 double-stranded DNA binding, 0042262 DNA protection; PDB: 2P2U_B.
Probab=39.98  E-value=59  Score=24.95  Aligned_cols=45  Identities=18%  Similarity=0.265  Sum_probs=35.2

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHHhhhhhhhHhHHHhhhhhhhhhhh
Q 031471           81 VNRDAVLARVETEKRISLIRAWEESEKSQAENKLRASFLEFFFFF  125 (159)
Q Consensus        81 ~dRDa~LArVe~EKrlSlIKAWEEsEKaKaeNKa~Kkls~I~sWE  125 (159)
                      ++|...--......+...|+.|-+.+.....++-..-.+.|..|.
T Consensus        15 l~~~~~~i~~~~~~~I~~i~~~~~~~~~~l~~~i~~l~~~l~~y~   59 (149)
T PF07352_consen   15 LQREIARIEAEANDEIARIKEWYEAEIAPLQNRIEYLEGLLQAYA   59 (149)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            445544445556778899999999999999999888888888774


No 16 
>PF03250 Tropomodulin:  Tropomodulin;  InterPro: IPR004934 Actin filaments have an intrinsic polarity, each with a fast-growing (barbed) end and a slow-growing (pointed) end. To regulate the dynamics at these ends, capping proteins have evolved that specifically bind to either the barbed or the pointed ends of the filament, where they block the association and dissociation of monomers. Pointed ends, for which actin monomers have significantly lower association and dissociation rate-constants than for barbed, are capped by either the Arp2/3 complex or tropomodulins [].  Tropomodulin is a novel tropomyosin regulatory protein that binds to the end of erythrocyte tropomyosin and blocks head-to-tail association of tropomyosin along actin filaments []. Limited proteolysis shows this protein is composed of two domains. The unstructured tropomyosin-binding region at the N terminus has an actin pointed-end-capping activity that is dramatically up-regulated by tropomyosin coating of the actin filament[]. The second region is found near the C terminus. This tropomyosin-independent capping-domain caps pure actin. ; GO: 0005523 tropomyosin binding, 0005856 cytoskeleton
Probab=37.88  E-value=40  Score=27.54  Aligned_cols=32  Identities=28%  Similarity=0.444  Sum_probs=24.5

Q ss_pred             CCCCCCCCchhHHHHHHHHHHHHHHHHHHHHhhh
Q 031471           72 AGEKSTEGSVNRDAVLARVETEKRISLIRAWEES  105 (159)
Q Consensus        72 ~~~k~~~gs~dRDa~LArVe~EKrlSlIKAWEEs  105 (159)
                      ..+|...|..|||++|.-++.+-  .-.+-||+.
T Consensus        55 QT~K~pTG~fdRe~Ll~~lekea--~~~~dre~~   86 (147)
T PF03250_consen   55 QTEKPPTGPFDREALLDYLEKEA--KELKDREDL   86 (147)
T ss_pred             ccCCCCCCCcCHHHHHHHHHHHH--HHHHhhhcc
Confidence            44677899999999999997554  445677774


No 17 
>PF08391 Ly49:  Ly49-like protein, N-terminal region;  InterPro: IPR013600 The sequences making up this entry are annotated as, or are similar to, Ly49 receptors (e.g. P20937 from SWISSPROT). These are type II transmembrane receptors expressed by mouse natural killer (NK) cells. They are classified as being activating (e.g.Ly49D and H) or inhibitory (e.g. Ly49A and G), depending on their effect on NK cell function []. They are members of the C-type lectin receptor superfamily [], and in fact in many family members this region is found immediately N-terminal to a lectin C-type domain (IPR001304 from INTERPRO). ; PDB: 1QO3_D 3C8J_D 1P4L_D 3C8K_D 3G8K_B 1JA3_B 3CAD_A 3G8L_A.
Probab=34.52  E-value=19  Score=28.05  Aligned_cols=8  Identities=50%  Similarity=1.933  Sum_probs=6.3

Q ss_pred             cCCceeee
Q 031471          126 FGLNCYYY  133 (159)
Q Consensus       126 ~~~~~~~~  133 (159)
                      -|.|||||
T Consensus       112 yg~kCYYF  119 (119)
T PF08391_consen  112 YGVKCYYF  119 (119)
T ss_dssp             ETTEEEEE
T ss_pred             eCceeeeC
Confidence            47899886


No 18 
>TIGR01195 oadG_fam sodium pump decarboxylases, gamma subunit. Most sequences scoring between the noise and trusted cutoffs are eukaryotic sodium channel proteins.
Probab=34.15  E-value=62  Score=23.27  Aligned_cols=26  Identities=19%  Similarity=0.039  Sum_probs=16.6

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhhhcC
Q 031471          134 FVSCVTLALLLLSINFLVLNYICRKF  159 (159)
Q Consensus       134 ~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (159)
                      -.++|.+.|++|.+-+-++..++++|
T Consensus        14 GM~~VF~fL~lLi~~i~~~~~~~~~~   39 (82)
T TIGR01195        14 GMGIVFLFLSLLIYAVRGMGKVVGRK   39 (82)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            34566666666666666666776654


No 19 
>PF06643 DUF1158:  Protein of unknown function (DUF1158);  InterPro: IPR010590 This family consists of several enterobacterial YbdJ proteins. The function of this family is unknown
Probab=32.50  E-value=24  Score=26.47  Aligned_cols=32  Identities=38%  Similarity=0.751  Sum_probs=25.4

Q ss_pred             CCceeeehhHHHHHHHHHHHHHHHHHHHhhhcC
Q 031471          127 GLNCYYYFVSCVTLALLLLSINFLVLNYICRKF  159 (159)
Q Consensus       127 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  159 (159)
                      .+|-.|-.+-|+-. |+|-.|.|+|+.+|-|++
T Consensus        46 DlnQlYTl~FClWF-LlLGaiEy~viRfiwrRw   77 (82)
T PF06643_consen   46 DLNQLYTLVFCLWF-LLLGAIEYFVIRFIWRRW   77 (82)
T ss_pred             hHHHHHHHHHHHHH-HHHhHHHHHHHHHHHHHH
Confidence            46778888888754 567789999999998864


No 20 
>PF02453 Reticulon:  Reticulon;  InterPro: IPR003388 Eukaryotic proteins of the reticulon (RTN) family all share an association with the endoplasmic reticulum (ER). Whereas amino-terminal regions are not related to one another, all reticulon proteins share a 200 amino acid residue region of sequence similarity at the C-terminal. This region contains two large hydrophobic regions separated by a 66 residue hydrophilic segment. The conserved hydrophobic C-terminal portion has been shown to play an essential role in the association of reticulons with the ER membrane. The hydrophobic portions are supposed to be membrane-embedded and the hydrophilic 66 residue localized to the lumenal/extracellular face of the membrane. Most reticulons have a di-lysine ER retention motif at the C-terminal. Because of their likely association with the rough as well as the smooth ER, the reticulons might play some role in transport processes or in regulation of intracellular calcium levels. It has been suggested that the reticulons may be serving as ER-associated channel-like complexes [, , , ].; GO: 0005783 endoplasmic reticulum; PDB: 2KO2_A 2JV5_A 2G31_A.
Probab=30.88  E-value=19  Score=26.58  Aligned_cols=45  Identities=22%  Similarity=0.152  Sum_probs=15.4

Q ss_pred             hHHHhhhhhhhhhhhcCCceeeehhHHHHHHHHHHHHHHHHHHHh
Q 031471          111 ENKLRASFLEFFFFFFGLNCYYYFVSCVTLALLLLSINFLVLNYI  155 (159)
Q Consensus       111 eNKa~Kkls~I~sWE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  155 (159)
                      =|.....+.++..|++.+.+.-.++.+..++.+.-.+|++.|-|+
T Consensus        93 ~n~~~~~~~~l~~~~~~~~~l~~~~~l~~l~~lg~~~s~~~L~~l  137 (169)
T PF02453_consen   93 INSVLSWLRRLVFGEDPKKSLKVFVVLYILSFLGSWFSFLTLLYL  137 (169)
T ss_dssp             CCHHHHHHHCCCHCT-TTGGG------------------------
T ss_pred             HHHHHHHHHHHHcCccHHHHHHHHHHHHHHHHHHHHcCHHHHHHH
Confidence            356667788888999888777777666666666666776666554


No 21 
>KOG4433 consensus Tweety transmembrane/cell surface protein [General function prediction only]
Probab=30.09  E-value=58  Score=31.41  Aligned_cols=24  Identities=38%  Similarity=0.649  Sum_probs=21.3

Q ss_pred             hhHHHHHHHHHHHHHHHHHHHhhh
Q 031471          134 FVSCVTLALLLLSINFLVLNYICR  157 (159)
Q Consensus       134 ~~~~~~~~~~~~~~~~~~~~~~~~  157 (159)
                      ++.|+..++|+|++-||++-.|||
T Consensus        45 lla~l~aa~l~l~Ll~ll~yli~~   68 (526)
T KOG4433|consen   45 LLAALAAACLGLSLLFLLFYLICR   68 (526)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            678888899999999999999986


No 22 
>KOG4684 consensus Uncharacterized conserved protein, contains C4-type Zn-finger [General function prediction only]
Probab=29.27  E-value=30  Score=30.71  Aligned_cols=31  Identities=13%  Similarity=0.108  Sum_probs=24.6

Q ss_pred             hhhhhhhhhhhcCCceeeehhHHHHHHHHHH
Q 031471          115 RASFLEFFFFFFGLNCYYYFVSCVTLALLLL  145 (159)
Q Consensus       115 ~Kkls~I~sWE~~~~~~~~~~~~~~~~~~~~  145 (159)
                      -||.|+|++-+++-.|..+|+-..+++++-.
T Consensus       195 CrKvSsvGsrfar~Ra~~ffilal~~avta~  225 (275)
T KOG4684|consen  195 CRKVSSVGSRFARRRALLFFILALTVAVTAV  225 (275)
T ss_pred             ccchhhhhhHHhhhhhHHHHHHHHHHHHHHH
Confidence            4789999999999999888877666665443


No 23 
>PF03929 PepSY_TM:  PepSY-associated TM helix;  InterPro: IPR005625  This domain represents a conserved transmembrane (TM) helix that is found in bacterial proteins. Coil residues are significantly more conserved than other residues and are frequently found within channels and transporters, where they introduce the flexibility and polarity required for transport across the membrane []. This TM helix associates with PepSY (peptidase (M4) and YpeB of subtilis). PepSY is a repeated region first identified in Thermoanaerobacter tengcongensis. The PepSY domain functions in the control of M4 peptidases through their propeptide and in the germination of spores. It may also play a part in regulating protease activity [].
Probab=29.03  E-value=95  Score=18.52  Aligned_cols=19  Identities=26%  Similarity=0.487  Sum_probs=12.6

Q ss_pred             ehhHHHHHHHHHHHHHHHH
Q 031471          133 YFVSCVTLALLLLSINFLV  151 (159)
Q Consensus       133 ~~~~~~~~~~~~~~~~~~~  151 (159)
                      ||+-.+.+++++++|.-++
T Consensus         7 w~~~i~al~~lv~~iTGl~   25 (27)
T PF03929_consen    7 WFGDIFALFMLVFAITGLI   25 (27)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            6666677777777766554


No 24 
>PF06459 RR_TM4-6:  Ryanodine Receptor TM 4-6;  InterPro: IPR009460  The release of Ca2+ ions from intracellular stores is a key step in a wide variety of cellular functions. In striated muscle, the release of Ca2+ from the sarcoplasmic reticulum (SR) leads to muscle contraction. Ca2+ release occurs through large, high-conductance Ca2+ release channels, also known as ryanodine receptors (RyRs) because they bind the plant alkaloid ryanodine with high affinity and specificity []. This region covers TM regions 4-6 of the ryanodine receptor 1 family.; GO: 0005219 ryanodine-sensitive calcium-release channel activity, 0006874 cellular calcium ion homeostasis, 0016021 integral to membrane
Probab=28.52  E-value=63  Score=28.18  Aligned_cols=12  Identities=50%  Similarity=0.944  Sum_probs=9.8

Q ss_pred             HHHHHHHHHHHH
Q 031471          143 LLLSINFLVLNY  154 (159)
Q Consensus       143 ~~~~~~~~~~~~  154 (159)
                      |-+.|||+.|-|
T Consensus       180 lAFaINFILLFY  191 (274)
T PF06459_consen  180 LAFAINFILLFY  191 (274)
T ss_pred             HHHHHHHHHHHH
Confidence            346899999988


No 25 
>KOG1725 consensus Protein involved in membrane traffic (YOP1/TB2/DP1/HVA22 family) [Intracellular trafficking, secretion, and vesicular transport]
Probab=26.59  E-value=89  Score=26.21  Aligned_cols=40  Identities=25%  Similarity=0.285  Sum_probs=26.2

Q ss_pred             hhhhhhhhhcCCceeeehhHHHHHHHHHH---HHHHHHHHHhh
Q 031471          117 SFLEFFFFFFGLNCYYYFVSCVTLALLLL---SINFLVLNYIC  156 (159)
Q Consensus       117 kls~I~sWE~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~~  156 (159)
                      ..-....|.+|.---|-|...+.|.+++|   ++-+|+.|+||
T Consensus        24 ~~f~~~E~~tgv~r~~~~~g~~~l~~v~l~~g~~~~l~cn~ig   66 (186)
T KOG1725|consen   24 GIFDQLEKFTGVPREYVFAGAILLLAVYLLFGSGGPLLCNLIG   66 (186)
T ss_pred             HHHHHHHHhhCCchhhhhHHHHHHHHHHHHhcccHHHHHHHHH
Confidence            34556778888877776666655444444   44578888886


No 26 
>PF08513 LisH:  LisH;  InterPro: IPR013720 The LisH motif is found in a large number of eukaryotic proteins, from metazoa, fungi and plants that have a wide range of functions. The recently solved structure of the LisH domain in the N-terminal region of LIS1 depicted it as a novel dimerization motif, and that other structural elements are likely to play an important role in dimerisation [, , ].  The LisH (lis homology) domain mediates protein dimerisation and tetramerisation. The LisH domain is found in Sif2, a component of the Set3 complex which is responsible for repressing meiotic genes. It has been shown that the LisH domain helps mediate interaction with components of the Set3 complex []. ; PDB: 2XTE_L 2XTC_B 2XTD_A 1UUJ_B.
Probab=25.96  E-value=53  Score=19.06  Aligned_cols=11  Identities=27%  Similarity=0.736  Sum_probs=9.1

Q ss_pred             HHHHHHHHhhh
Q 031471          147 INFLVLNYICR  157 (159)
Q Consensus       147 ~~~~~~~~~~~  157 (159)
                      ||.||++|+.+
T Consensus         3 Ln~lI~~YL~~   13 (27)
T PF08513_consen    3 LNQLIYDYLVE   13 (27)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
Confidence            78899999865


No 27 
>PF10577 UPF0560:  Uncharacterised protein family UPF0560;  InterPro: IPR018890  This family of proteins has no known function. 
Probab=25.75  E-value=53  Score=33.12  Aligned_cols=26  Identities=27%  Similarity=0.410  Sum_probs=14.6

Q ss_pred             ehhHH-HHHHHHHHHHHHHHHHHhhhc
Q 031471          133 YFVSC-VTLALLLLSINFLVLNYICRK  158 (159)
Q Consensus       133 ~~~~~-~~~~~~~~~~~~~~~~~~~~~  158 (159)
                      +|... +.-.+|++.|-|.||-|.||.
T Consensus       273 ~fLl~ILG~~~livl~lL~vLl~yCrr  299 (807)
T PF10577_consen  273 VFLLAILGGTALIVLILLCVLLCYCRR  299 (807)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhc
Confidence            34333 333344444556678888985


No 28 
>PF08928 DUF1910:  Domain of unknown function (DUF1910);  InterPro: IPR015024 This domain is found in hypothetical bacterial proteins. 
Probab=25.60  E-value=58  Score=23.53  Aligned_cols=21  Identities=24%  Similarity=0.459  Sum_probs=11.6

Q ss_pred             hhhcCCceeeehhHHHHHHHHH
Q 031471          123 FFFFGLNCYYYFVSCVTLALLL  144 (159)
Q Consensus       123 sWE~~~~~~~~~~~~~~~~~~~  144 (159)
                      .|+.+ +-|.+.+-.+.|++||
T Consensus        83 ~~~~~-~~Y~~~lwllsLgiLL  103 (117)
T PF08928_consen   83 IWDEN-DGYIYMLWLLSLGILL  103 (117)
T ss_pred             hccCC-chHHHHHHHHHHHHHH
Confidence            67666 4455555555555543


No 29 
>smart00667 LisH Lissencephaly type-1-like homology motif. Alpha-helical motif present in Lis1, treacle, Nopp140, some katanin p60 subunits, muskelin, tonneau, LEUNIG and numerous WD40 repeat-containing proteins. It is suggested that LisH motifs contribute to the regulation of microtubule dynamics, either by mediating dimerisation, or else by binding cytoplasmic dynein heavy chain or microtubules directly.
Probab=24.85  E-value=56  Score=17.74  Aligned_cols=13  Identities=38%  Similarity=0.774  Sum_probs=9.1

Q ss_pred             HHHHHHHHHhhhc
Q 031471          146 SINFLVLNYICRK  158 (159)
Q Consensus       146 ~~~~~~~~~~~~~  158 (159)
                      .+|.+|++|+.+.
T Consensus         5 ~l~~lI~~yL~~~   17 (34)
T smart00667        5 ELNRLILEYLLRN   17 (34)
T ss_pred             HHHHHHHHHHHHc
Confidence            3677888887753


No 30 
>PF05568 ASFV_J13L:  African swine fever virus J13L protein;  InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=24.69  E-value=71  Score=26.99  Aligned_cols=20  Identities=35%  Similarity=0.785  Sum_probs=16.6

Q ss_pred             HHHHHHHHHHHHHHHHHhhh
Q 031471          138 VTLALLLLSINFLVLNYICR  157 (159)
Q Consensus       138 ~~~~~~~~~~~~~~~~~~~~  157 (159)
                      +.+++.+|.|-|+||-|+|.
T Consensus        34 ILiaIvVliiiiivli~lcs   53 (189)
T PF05568_consen   34 ILIAIVVLIIIIIVLIYLCS   53 (189)
T ss_pred             HHHHHHHHHHHHHHHHHHHh
Confidence            45677888899999999994


No 31 
>PRK02251 putative septation inhibitor protein; Reviewed
Probab=24.11  E-value=83  Score=23.64  Aligned_cols=19  Identities=26%  Similarity=0.679  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHHHHHhh
Q 031471          138 VTLALLLLSINFLVLNYIC  156 (159)
Q Consensus       138 ~~~~~~~~~~~~~~~~~~~  156 (159)
                      +.++|+++.+-.||.+||.
T Consensus        37 ~m~~lm~~Gl~WlvvyYl~   55 (87)
T PRK02251         37 LFVALMIIGLIWLVVYYLS   55 (87)
T ss_pred             HHHHHHHHHHHHHHHHhhh
Confidence            4566777788888888874


No 32 
>PRK00159 putative septation inhibitor protein; Reviewed
Probab=23.66  E-value=86  Score=23.60  Aligned_cols=19  Identities=37%  Similarity=0.875  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHHHHHhh
Q 031471          138 VTLALLLLSINFLVLNYIC  156 (159)
Q Consensus       138 ~~~~~~~~~~~~~~~~~~~  156 (159)
                      +.++|+++.+-.+|.+||.
T Consensus        36 ~m~glm~~GllWlvvyYl~   54 (87)
T PRK00159         36 LMLGLMLIGLAWLVVNYLA   54 (87)
T ss_pred             HHHHHHHHHHHHHHHHhhc
Confidence            4567777788888888875


No 33 
>COG3924 Predicted membrane protein [Function unknown]
Probab=23.52  E-value=43  Score=25.13  Aligned_cols=19  Identities=42%  Similarity=0.665  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHHHHHhhhcC
Q 031471          141 ALLLLSINFLVLNYICRKF  159 (159)
Q Consensus       141 ~~~~~~~~~~~~~~~~~~~  159 (159)
                      +-++|-|-|.++-|+|-||
T Consensus        49 aCi~lPllFi~l~~~mvkf   67 (80)
T COG3924          49 ACILLPLLFIVLCWAMVKF   67 (80)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            3445555666666666554


No 34 
>PF05933 Fun_ATP-synt_8:  Fungal ATP synthase protein 8 (A6L);  InterPro: IPR009230 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunit 8 found in the F0 complex of mitochondrial F-ATPases from fungi. This subunit appears to be an integral component of the stator stalk in yeast mitochondrial F-ATPases []. The stator stalk is anchored in the membrane, and acts to prevent futile rotation of the ATPase subunits relative to the rotor during coupled ATP synthesis/hydrolysis. This subunit differs in sequence between fungi, Metazoa (IPR001421 from INTERPRO) and plants (IPR003319 from INTERPRO). More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)
Probab=22.15  E-value=1.1e+02  Score=20.92  Aligned_cols=21  Identities=33%  Similarity=0.784  Sum_probs=15.7

Q ss_pred             eehhHHHHHHHHHHHHHHHHH
Q 031471          132 YYFVSCVTLALLLLSINFLVL  152 (159)
Q Consensus       132 ~~~~~~~~~~~~~~~~~~~~~  152 (159)
                      +||+.-++.+++++++...+.
T Consensus         7 FyF~Nql~~~f~~l~il~yl~   27 (48)
T PF05933_consen    7 FYFVNQLSFGFLILSILLYLF   27 (48)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            688888888888887765443


No 35 
>PF06781 UPF0233:  Uncharacterised protein family (UPF0233);  InterPro: IPR009619 This is a group of proteins of unknown function.
Probab=22.03  E-value=84  Score=23.43  Aligned_cols=28  Identities=29%  Similarity=0.516  Sum_probs=18.3

Q ss_pred             CceeeehhHHHHHHHHHHHHHHHHHHHhhh
Q 031471          128 LNCYYYFVSCVTLALLLLSINFLVLNYICR  157 (159)
Q Consensus       128 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  157 (159)
                      .|--+|-.  +.++|+++.+-.+|.+||..
T Consensus        28 ~sp~W~~p--~m~~lmllGL~WiVvyYi~~   55 (87)
T PF06781_consen   28 PSPRWYAP--LMLGLMLLGLLWIVVYYISG   55 (87)
T ss_pred             CCCccHHH--HHHHHHHHHHHHHhhhhccc
Confidence            34444433  45667778888889999854


Done!