Citrus Sinensis ID: 031472


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MKRDREMAAIDTANCLMLLSKVGETDQGKRVFACKTCNKEFPSFQALGGHRASHKKPKLMTMASSGEDFDQTQMPPASPRKPKTHECSICGLEFAIGQALGGHMRRHRAAAAMGAVADGLVTRPLLPLPVLKKSNSCKRVFCLDLNLMPTGDDLKLWVA
cccccccccHHHHHHHHHHccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*********IDTANCLMLLSKVGETDQGKRVFACKTCNKEFPSFQAL********KP****************************ECSICGLEFAIGQALGGHMRRHRAA***************************KRVFCLDLNLMPTGDDLKLWVA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRDREMAAIDTANCLMLLSKVGETDQGKRVFACKTCNKEFPSFQALGGHRASHKKPKLMTMASSGEDFDQTQMPPASPRKPKTHECSICGLEFAIGQALGGHMRRHRAAAAMGAVADGLVTRPLLPLPVLKKSNSCKRVFCLDLNLMPTGDDLKLWVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger protein ZAT12 Transcriptional repressor involved in light acclimation, cold and oxidative stress responses. May regulate a collection of transcripts involved in response to high-light, cold and oxidative stress.probableQ42410

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NJQ, chain A
Confidence level:very confident
Coverage over the Query: 80-115
View the alignment between query and template
View the model in PyMOL
Template: 1NJQ, chain A
Confidence level:very confident
Coverage over the Query: 27-62
View the alignment between query and template
View the model in PyMOL
Template: 2I13, chain A
Confidence level:confident
Coverage over the Query: 15-147
View the alignment between query and template
View the model in PyMOL