Query         031501
Match_columns 158
No_of_seqs    129 out of 179
Neff          4.0 
Searched_HMMs 46136
Date          Fri Mar 29 15:01:04 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031501.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/031501hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04640 PLATZ:  PLATZ transcri 100.0 1.5E-42 3.2E-47  246.3   5.8   72    5-76      1-72  (72)
  2 PF12855 Ecl1:  Life-span regul  92.3   0.027 5.8E-07   36.7  -0.8   30   52-81      5-37  (43)
  3 PRK01343 zinc-binding protein;  91.2   0.079 1.7E-06   36.6   0.6   29   53-81      9-38  (57)
  4 PRK00418 DNA gyrase inhibitor;  89.4    0.13 2.7E-06   36.1   0.3   29   53-81      6-39  (62)
  5 COG3024 Uncharacterized protei  88.7    0.15 3.3E-06   36.1   0.3   29   53-81      7-40  (65)
  6 PF03884 DUF329:  Domain of unk  88.6    0.08 1.7E-06   36.4  -1.1   28   54-81      3-35  (57)
  7 PF10013 DUF2256:  Uncharacteri  82.2    0.46   1E-05   31.1   0.2   23   53-75      8-39  (42)
  8 PF09889 DUF2116:  Uncharacteri  76.6    0.77 1.7E-05   31.7  -0.1   29   54-82      4-32  (59)
  9 PF06467 zf-FCS:  MYM-type Zinc  70.8     1.1 2.5E-05   27.4  -0.3   25   51-75      4-40  (43)
 10 PF13240 zinc_ribbon_2:  zinc-r  70.3     2.1 4.5E-05   24.2   0.7   17   55-71      1-17  (23)
 11 COG4338 Uncharacterized protei  69.4    0.45 9.7E-06   32.4  -2.6   24   52-75     11-43  (54)
 12 PF13248 zf-ribbon_3:  zinc-rib  62.3     4.2   9E-05   23.2   0.9   18   54-71      3-20  (26)
 13 COG4068 Uncharacterized protei  61.9     2.7 5.8E-05   29.7   0.1   23   53-75      8-30  (64)
 14 PF04570 DUF581:  Protein of un  48.5     5.5 0.00012   27.5  -0.1   29   52-80     15-52  (58)
 15 PF08002 DUF1697:  Protein of u  44.2      13 0.00028   28.8   1.3   30   10-40     16-48  (137)
 16 PF04438 zf-HIT:  HIT zinc fing  43.8     8.2 0.00018   23.1   0.1   20   55-75      4-29  (30)
 17 smart00746 TRASH metallochaper  35.5      21 0.00045   18.8   1.0   12   66-77     23-34  (39)
 18 PF01286 XPA_N:  XPA protein N-  30.7      21 0.00047   22.2   0.5   23   54-76      4-26  (34)
 19 KOG3362 Predicted BBOX Zn-fing  30.5      30 0.00066   28.3   1.5   27   51-77    116-147 (156)
 20 PF12773 DZR:  Double zinc ribb  29.2      25 0.00054   22.0   0.7   11   54-64     13-23  (50)
 21 TIGR00412 redox_disulf_2 small  27.7      91   0.002   21.0   3.3   33   11-44     32-66  (76)
 22 PF06906 DUF1272:  Protein of u  26.7      41 0.00088   23.4   1.4   24   54-77      6-32  (57)
 23 KOG2857 Predicted MYND Zn-fing  24.7      26 0.00055   28.7   0.1   23   53-75      5-33  (157)
 24 PRK00807 50S ribosomal protein  23.6      31 0.00066   23.0   0.3   23   54-76      2-36  (52)
 25 PF04945 YHS:  YHS domain;  Int  22.5      23  0.0005   22.3  -0.5   12   66-77     24-35  (47)
 26 COG0199 RpsN Ribosomal protein  21.3      57  0.0012   22.7   1.3   23   41-63      9-31  (61)

No 1  
>PF04640 PLATZ:  PLATZ transcription factor;  InterPro: IPR006734 This family includes a conserved region in several uncharacterised plant proteins.
Probab=100.00  E-value=1.5e-42  Score=246.34  Aligned_cols=72  Identities=72%  Similarity=1.223  Sum_probs=71.1

Q ss_pred             EeecccceeecchhhhhhccCCceEEEECCceEEEecCCCCCCCCCCCCCccccccccccCCCeeeccccee
Q 031501            5 RRSSYHDVIRVSEIQKVLDISGVQTYVINSARVVFLNERPQPRPGKGVTNTCEVCDRSLLDSFRFCSLGCKI   76 (158)
Q Consensus         5 RRssY~dVVrv~diqkllDiS~IQtYvINsakVVFLn~RPq~r~~~g~~~~C~~C~R~L~d~~~FCSL~CKv   76 (158)
                      |||||||||||+|||||||||+||||+||+++|||||+|||+++.++.++.|++|+|+|+|+|+||||+|||
T Consensus         1 Rr~sY~dVVrv~di~kl~D~s~IQtY~iNs~kVVfLn~Rpq~~~~~~~~~~C~~C~R~L~d~~~fCSl~CKv   72 (72)
T PF04640_consen    1 RRYSYHDVVRVSDIQKLLDCSGIQTYVINSAKVVFLNPRPQSRPSKGSGNICETCHRSLQDPYRFCSLSCKV   72 (72)
T ss_pred             CcccccceEEHHHhHhhccccccEEEEeCCceEEEEccCCcCCCCCCCCCccCCCCCCCCCCCeEEeeeEEC
Confidence            899999999999999999999999999999999999999999999999999999999999999999999996


No 2  
>PF12855 Ecl1:  Life-span regulatory factor;  InterPro: IPR024368  The fungal proteins in this entry are involved in the regulation of chronological life-span [, ]. Overexpression of these proteins has been shown to extend the chronological life-span of wild-type strains. The mechanism by which this happens is not known, but microarray data suggests that they may function as pleiptropic stress regulators.
Probab=92.34  E-value=0.027  Score=36.72  Aligned_cols=30  Identities=30%  Similarity=0.723  Sum_probs=25.1

Q ss_pred             CCCccccccccc---cCCCeeecccceeeccch
Q 031501           52 VTNTCEVCDRSL---LDSFRFCSLGCKIVGTSK   81 (158)
Q Consensus        52 ~~~~C~~C~R~L---~d~~~FCSL~CKv~~~~~   81 (158)
                      ..+.|.+|++-+   .+...|||-+|++.+..+
T Consensus         5 F~~yC~~Cdk~~~~~~~~~lYCSe~Cr~~D~~~   37 (43)
T PF12855_consen    5 FNDYCIVCDKQIDPPDDGSLYCSEECRLKDQEK   37 (43)
T ss_pred             hhhHHHHhhccccCCCCCccccCHHHHhHhhhc
Confidence            347899999999   668999999999976554


No 3  
>PRK01343 zinc-binding protein; Provisional
Probab=91.24  E-value=0.079  Score=36.59  Aligned_cols=29  Identities=24%  Similarity=0.607  Sum_probs=23.7

Q ss_pred             CCccccccccccCCC-eeecccceeeccch
Q 031501           53 TNTCEVCDRSLLDSF-RFCSLGCKIVGTSK   81 (158)
Q Consensus        53 ~~~C~~C~R~L~d~~-~FCSL~CKv~~~~~   81 (158)
                      ...|-+|++.....| -|||-.|+..+..+
T Consensus         9 ~~~CP~C~k~~~~~~rPFCS~RC~~iDLg~   38 (57)
T PRK01343          9 TRPCPECGKPSTREAYPFCSERCRDIDLNR   38 (57)
T ss_pred             CCcCCCCCCcCcCCCCcccCHHHhhhhHHH
Confidence            578999999877655 59999999876654


No 4  
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=89.38  E-value=0.13  Score=36.11  Aligned_cols=29  Identities=31%  Similarity=0.812  Sum_probs=23.0

Q ss_pred             CCcccccccccc---C-CCe-eecccceeeccch
Q 031501           53 TNTCEVCDRSLL---D-SFR-FCSLGCKIVGTSK   81 (158)
Q Consensus        53 ~~~C~~C~R~L~---d-~~~-FCSL~CKv~~~~~   81 (158)
                      +..|-+|++...   + +|+ |||-.||+.+..+
T Consensus         6 ~v~CP~C~k~~~w~~~~~~rPFCS~RCk~IDLg~   39 (62)
T PRK00418          6 TVNCPTCGKPVEWGEISPFRPFCSKRCQLIDLGE   39 (62)
T ss_pred             cccCCCCCCcccccCCCCcCCcccHHHHhhhHHH
Confidence            468999999874   3 675 9999999976655


No 5  
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=88.68  E-value=0.15  Score=36.14  Aligned_cols=29  Identities=34%  Similarity=0.864  Sum_probs=23.5

Q ss_pred             CCccccccccccC----CCe-eecccceeeccch
Q 031501           53 TNTCEVCDRSLLD----SFR-FCSLGCKIVGTSK   81 (158)
Q Consensus        53 ~~~C~~C~R~L~d----~~~-FCSL~CKv~~~~~   81 (158)
                      +-.|-+|++...-    +|+ |||-.||+-+...
T Consensus         7 ~v~CP~Cgkpv~w~~~s~frPFCSkRCklIDLg~   40 (65)
T COG3024           7 TVPCPTCGKPVVWGEESPFRPFCSKRCKLIDLGE   40 (65)
T ss_pred             cccCCCCCCcccccccCCcCcchhHhhhhcchhh
Confidence            4679999988874    666 9999999976655


No 6  
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=88.58  E-value=0.08  Score=36.42  Aligned_cols=28  Identities=32%  Similarity=0.857  Sum_probs=17.4

Q ss_pred             CccccccccccC----CCe-eecccceeeccch
Q 031501           54 NTCEVCDRSLLD----SFR-FCSLGCKIVGTSK   81 (158)
Q Consensus        54 ~~C~~C~R~L~d----~~~-FCSL~CKv~~~~~   81 (158)
                      ..|-+|++...-    +|+ |||-.||+.+...
T Consensus         3 v~CP~C~k~~~~~~~n~~rPFCS~RCk~iDLg~   35 (57)
T PF03884_consen    3 VKCPICGKPVEWSPENPFRPFCSERCKLIDLGR   35 (57)
T ss_dssp             EE-TTT--EEE-SSSSS--SSSSHHHHHHHHS-
T ss_pred             ccCCCCCCeecccCCCCcCCcccHhhcccCHHH
Confidence            469999988875    677 9999999876554


No 7  
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=82.19  E-value=0.46  Score=31.10  Aligned_cols=23  Identities=35%  Similarity=1.002  Sum_probs=20.1

Q ss_pred             CCcccccccccc---------CCCeeecccce
Q 031501           53 TNTCEVCDRSLL---------DSFRFCSLGCK   75 (158)
Q Consensus        53 ~~~C~~C~R~L~---------d~~~FCSL~CK   75 (158)
                      ..+|.+|+|...         |...|||-.|.
T Consensus         8 ~K~C~~C~rpf~WRKKW~~~Wd~VkYCS~rCR   39 (42)
T PF10013_consen    8 SKICPVCGRPFTWRKKWARCWDEVKYCSDRCR   39 (42)
T ss_pred             CCcCcccCCcchHHHHHHHhchhhccHHHHhc
Confidence            578999999987         57899999996


No 8  
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=76.59  E-value=0.77  Score=31.73  Aligned_cols=29  Identities=24%  Similarity=0.598  Sum_probs=24.6

Q ss_pred             CccccccccccCCCeeecccceeeccchh
Q 031501           54 NTCEVCDRSLLDSFRFCSLGCKIVGTSKN   82 (158)
Q Consensus        54 ~~C~~C~R~L~d~~~FCSL~CKv~~~~~~   82 (158)
                      .+|..||.++...-.|||=.|+-....+.
T Consensus         4 kHC~~CG~~Ip~~~~fCS~~C~~~~~k~q   32 (59)
T PF09889_consen    4 KHCPVCGKPIPPDESFCSPKCREEYRKRQ   32 (59)
T ss_pred             CcCCcCCCcCCcchhhhCHHHHHHHHHHH
Confidence            68999999999999999999997655543


No 9  
>PF06467 zf-FCS:  MYM-type Zinc finger with FCS sequence motif;  InterPro: IPR010507 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  MYM-type zinc fingers were identified in MYM family proteins []. Human protein Q14202 from SWISSPROT is involved in a chromosomal translocation and may be responsible for X-linked retardation in XQ13.1 []. Q9UBW7 from SWISSPROT is also involved in disease. In myeloproliferative disorders it is fused to FGF receptor 1 []; in atypical myeloproliferative disorders it is rearranged []. Members of the family generally are involved in development. This Zn-finger domain functions as a transcriptional trans-activator of late vaccinia viral genes, and orthologues are also found in all nucleocytoplasmic large DNA viruses, NCLDV. This domain is also found fused to the C termini of recombinases from certain prokaryotic transposons []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2L8E_A 2DAS_A.
Probab=70.82  E-value=1.1  Score=27.38  Aligned_cols=25  Identities=28%  Similarity=0.669  Sum_probs=15.5

Q ss_pred             CCCCccccccccccC-C-----------Ceeecccce
Q 031501           51 GVTNTCEVCDRSLLD-S-----------FRFCSLGCK   75 (158)
Q Consensus        51 g~~~~C~~C~R~L~d-~-----------~~FCSL~CK   75 (158)
                      .....|..|++.+.. +           ..|||..|.
T Consensus         4 ~~~~~C~~C~~~~~~~~~~~~~~~~g~~~~FCS~~C~   40 (43)
T PF06467_consen    4 LKMKTCSYCKKYIPNKPTMIEVQYDGKMKQFCSQSCL   40 (43)
T ss_dssp             -SCEE-TTT--EEECCC----EE-TTTTSCCSSHHHH
T ss_pred             CcCCcCcccCCcccCCCccccccccCcccChhCHHHH
Confidence            346789999877754 3           379999985


No 10 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=70.26  E-value=2.1  Score=24.20  Aligned_cols=17  Identities=29%  Similarity=0.835  Sum_probs=14.5

Q ss_pred             ccccccccccCCCeeec
Q 031501           55 TCEVCDRSLLDSFRFCS   71 (158)
Q Consensus        55 ~C~~C~R~L~d~~~FCS   71 (158)
                      .|..|+..|.+...||+
T Consensus         1 ~Cp~CG~~~~~~~~fC~   17 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKFCP   17 (23)
T ss_pred             CCcccCCCCCCcCcchh
Confidence            37889999999889986


No 11 
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=69.40  E-value=0.45  Score=32.45  Aligned_cols=24  Identities=33%  Similarity=0.931  Sum_probs=20.8

Q ss_pred             CCCcccccccccc---------CCCeeecccce
Q 031501           52 VTNTCEVCDRSLL---------DSFRFCSLGCK   75 (158)
Q Consensus        52 ~~~~C~~C~R~L~---------d~~~FCSL~CK   75 (158)
                      .+.+|.+|+|...         |...|||-.|+
T Consensus        11 p~KICpvCqRPFsWRkKW~~cWDeVKyCSeRCr   43 (54)
T COG4338          11 PDKICPVCQRPFSWRKKWARCWDEVKYCSERCR   43 (54)
T ss_pred             chhhhhhhcCchHHHHHHHHHHHHHHHHHHHHH
Confidence            4689999999887         56889999998


No 12 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=62.34  E-value=4.2  Score=23.22  Aligned_cols=18  Identities=22%  Similarity=0.621  Sum_probs=15.2

Q ss_pred             CccccccccccCCCeeec
Q 031501           54 NTCEVCDRSLLDSFRFCS   71 (158)
Q Consensus        54 ~~C~~C~R~L~d~~~FCS   71 (158)
                      ..|..|+..+.+.++||+
T Consensus         3 ~~Cp~Cg~~~~~~~~fC~   20 (26)
T PF13248_consen    3 MFCPNCGAEIDPDAKFCP   20 (26)
T ss_pred             CCCcccCCcCCcccccCh
Confidence            578899998888899986


No 13 
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=61.90  E-value=2.7  Score=29.68  Aligned_cols=23  Identities=26%  Similarity=0.676  Sum_probs=21.2

Q ss_pred             CCccccccccccCCCeeecccce
Q 031501           53 TNTCEVCDRSLLDSFRFCSLGCK   75 (158)
Q Consensus        53 ~~~C~~C~R~L~d~~~FCSL~CK   75 (158)
                      ..+|.+|+..+...-.|||-.|.
T Consensus         8 H~HC~VCg~aIp~de~~CSe~C~   30 (64)
T COG4068           8 HRHCVVCGKAIPPDEQVCSEECG   30 (64)
T ss_pred             CccccccCCcCCCccchHHHHHH
Confidence            46899999999999999999997


No 14 
>PF04570 DUF581:  Protein of unknown function (DUF581);  InterPro: IPR007650 This is a family of uncharacterised proteins.
Probab=48.45  E-value=5.5  Score=27.46  Aligned_cols=29  Identities=31%  Similarity=0.689  Sum_probs=21.6

Q ss_pred             CCCcccccccccc---CC--Ce----eecccceeeccc
Q 031501           52 VTNTCEVCDRSLL---DS--FR----FCSLGCKIVGTS   80 (158)
Q Consensus        52 ~~~~C~~C~R~L~---d~--~~----FCSL~CKv~~~~   80 (158)
                      .-..|..|++.|.   |-  |+    |||..|--.-|.
T Consensus        15 FL~~C~~C~k~L~~~~DiymYrGd~aFCS~ECR~~qi~   52 (58)
T PF04570_consen   15 FLSFCYLCKKKLDPGKDIYMYRGDKAFCSEECRSQQIL   52 (58)
T ss_pred             HHHHHHccCCCCCCCCCeeeeccccccccHHHHHHHHH
Confidence            4568999999999   32  44    999999765443


No 15 
>PF08002 DUF1697:  Protein of unknown function (DUF1697);  InterPro: IPR012545 This family contains many hypothetical bacterial proteins.; PDB: 2HIY_B.
Probab=44.21  E-value=13  Score=28.78  Aligned_cols=30  Identities=37%  Similarity=0.674  Sum_probs=20.7

Q ss_pred             cceeecchhhhh---hccCCceEEEECCceEEEe
Q 031501           10 HDVIRVSEIQKV---LDISGVQTYVINSARVVFL   40 (158)
Q Consensus        10 ~dVVrv~diqkl---lDiS~IQtYvINsakVVFL   40 (158)
                      ++-|+..|+...   +-..+|+|| |||.-|||-
T Consensus        16 ~nki~MaeLr~~l~~~Gf~~V~Ty-i~SGNvvf~   48 (137)
T PF08002_consen   16 KNKIKMAELREALEDLGFTNVRTY-IQSGNVVFE   48 (137)
T ss_dssp             BS---HHHHHHHHHHCT-EEEEEE-TTTTEEEEE
T ss_pred             CCcccHHHHHHHHHHcCCCCceEE-EeeCCEEEe
Confidence            455777777664   568899999 788899997


No 16 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=43.83  E-value=8.2  Score=23.07  Aligned_cols=20  Identities=40%  Similarity=0.969  Sum_probs=12.0

Q ss_pred             ccccccccccC------CCeeecccce
Q 031501           55 TCEVCDRSLLD------SFRFCSLGCK   75 (158)
Q Consensus        55 ~C~~C~R~L~d------~~~FCSL~CK   75 (158)
                      .|.+|+. ...      ...||||.|.
T Consensus         4 ~C~vC~~-~~kY~Cp~C~~~~CSl~C~   29 (30)
T PF04438_consen    4 LCSVCGN-PAKYRCPRCGARYCSLACY   29 (30)
T ss_dssp             EETSSSS-EESEE-TTT--EESSHHHH
T ss_pred             CCccCcC-CCEEECCCcCCceeCcEeE
Confidence            4666666 221      4679999984


No 17 
>smart00746 TRASH metallochaperone-like domain.
Probab=35.55  E-value=21  Score=18.84  Aligned_cols=12  Identities=42%  Similarity=0.766  Sum_probs=8.9

Q ss_pred             CCeeecccceee
Q 031501           66 SFRFCSLGCKIV   77 (158)
Q Consensus        66 ~~~FCSL~CKv~   77 (158)
                      .+.|||..|...
T Consensus        23 ~~~FCs~~c~~~   34 (39)
T smart00746       23 VFYFCSSKCLSK   34 (39)
T ss_pred             EEEEeCHHHHHH
Confidence            468999888653


No 18 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=30.75  E-value=21  Score=22.18  Aligned_cols=23  Identities=17%  Similarity=0.652  Sum_probs=14.3

Q ss_pred             CccccccccccCCCeeeccccee
Q 031501           54 NTCEVCDRSLLDSFRFCSLGCKI   76 (158)
Q Consensus        54 ~~C~~C~R~L~d~~~FCSL~CKv   76 (158)
                      ..|..|+..++|+|.+=...+.|
T Consensus         4 ~~C~eC~~~f~dSyL~~~F~~~V   26 (34)
T PF01286_consen    4 PKCDECGKPFMDSYLLNNFDLPV   26 (34)
T ss_dssp             EE-TTT--EES-SSCCCCTS-S-
T ss_pred             chHhHhCCHHHHHHHHHhCCccc
Confidence            57999999999999887777665


No 19 
>KOG3362 consensus Predicted BBOX Zn-finger protein [General function prediction only]
Probab=30.47  E-value=30  Score=28.28  Aligned_cols=27  Identities=22%  Similarity=0.551  Sum_probs=18.4

Q ss_pred             CCCCccccccccccC-----CCeeecccceee
Q 031501           51 GVTNTCEVCDRSLLD-----SFRFCSLGCKIV   77 (158)
Q Consensus        51 g~~~~C~~C~R~L~d-----~~~FCSL~CKv~   77 (158)
                      ..-..|.+||-.-.-     +.+|||++|-..
T Consensus       116 P~r~fCaVCG~~S~ysC~~CG~kyCsv~C~~~  147 (156)
T KOG3362|consen  116 PLRKFCAVCGYDSKYSCVNCGTKYCSVRCLKT  147 (156)
T ss_pred             CcchhhhhcCCCchhHHHhcCCceeechhhhh
Confidence            445788888832221     578999999753


No 20 
>PF12773 DZR:  Double zinc ribbon
Probab=29.16  E-value=25  Score=22.02  Aligned_cols=11  Identities=27%  Similarity=0.640  Sum_probs=5.2

Q ss_pred             Ccccccccccc
Q 031501           54 NTCEVCDRSLL   64 (158)
Q Consensus        54 ~~C~~C~R~L~   64 (158)
                      ..|..|+..|.
T Consensus        13 ~fC~~CG~~l~   23 (50)
T PF12773_consen   13 KFCPHCGTPLP   23 (50)
T ss_pred             cCChhhcCChh
Confidence            44444444444


No 21 
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2. This small protein is found in three archaeal species so far (Methanococcus jannaschii, Archeoglobus fulgidus, and Methanobacterium thermoautotrophicum) as well as in Anabaena PCC7120. It is homologous to thioredoxins, glutaredoxins, and protein disulfide isomerases, and shares with them a redox-active disulfide. The redox active disulfide region CXXC motif resembles neither thioredoxin nor glutaredoxin. A closely related protein found in the same three Archaea, described by redox_disulf_1, has a glutaredoxin-like CP[YH]C sequence; it has been characterized in functional assays as redox-active but unlikely to be a thioredoxin or glutaredoxin.
Probab=27.71  E-value=91  Score=21.01  Aligned_cols=33  Identities=9%  Similarity=0.376  Sum_probs=22.5

Q ss_pred             ceeecchhhhh--hccCCceEEEECCceEEEecCCC
Q 031501           11 DVIRVSEIQKV--LDISGVQTYVINSARVVFLNERP   44 (158)
Q Consensus        11 dVVrv~diqkl--lDiS~IQtYvINsakVVFLn~RP   44 (158)
                      .+++++|++..  +++-+|-|..+||..+ |....|
T Consensus        32 ~~~~v~~~~~a~~~~v~~vPti~i~G~~~-~~G~~~   66 (76)
T TIGR00412        32 EFEKVTDMNEILEAGVTATPGVAVDGELV-IMGKIP   66 (76)
T ss_pred             EEEEeCCHHHHHHcCCCcCCEEEECCEEE-EEeccC
Confidence            35666655554  7899999999988655 555433


No 22 
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=26.72  E-value=41  Score=23.38  Aligned_cols=24  Identities=33%  Similarity=0.829  Sum_probs=20.0

Q ss_pred             CccccccccccC---CCeeecccceee
Q 031501           54 NTCEVCDRSLLD---SFRFCSLGCKIV   77 (158)
Q Consensus        54 ~~C~~C~R~L~d---~~~FCSL~CKv~   77 (158)
                      ..|+.|++.|..   ...-||..|-+=
T Consensus         6 pnCE~C~~dLp~~s~~A~ICSfECTFC   32 (57)
T PF06906_consen    6 PNCECCDKDLPPDSPEAYICSFECTFC   32 (57)
T ss_pred             CCccccCCCCCCCCCcceEEeEeCccc
Confidence            579999999985   378999999873


No 23 
>KOG2857 consensus Predicted MYND Zn-finger protein/hormone receptor interactor [Transcription]
Probab=24.73  E-value=26  Score=28.69  Aligned_cols=23  Identities=43%  Similarity=0.863  Sum_probs=15.5

Q ss_pred             CCccccccccccC------CCeeecccce
Q 031501           53 TNTCEVCDRSLLD------SFRFCSLGCK   75 (158)
Q Consensus        53 ~~~C~~C~R~L~d------~~~FCSL~CK   75 (158)
                      +-+|.+|.+.-.-      .+-||||.|-
T Consensus         5 t~tC~ic~e~~~KYKCpkC~vPYCSl~Cf   33 (157)
T KOG2857|consen    5 TTTCVICLESEIKYKCPKCSVPYCSLPCF   33 (157)
T ss_pred             eeeehhhhcchhhccCCCCCCccccchhh
Confidence            4466777665421      5789999995


No 24 
>PRK00807 50S ribosomal protein L24e; Validated
Probab=23.57  E-value=31  Score=22.95  Aligned_cols=23  Identities=35%  Similarity=0.873  Sum_probs=16.9

Q ss_pred             Ccccccccccc----------C--CCeeeccccee
Q 031501           54 NTCEVCDRSLL----------D--SFRFCSLGCKI   76 (158)
Q Consensus        54 ~~C~~C~R~L~----------d--~~~FCSL~CKv   76 (158)
                      +.|..|+..+.          |  .|.|||=.|+-
T Consensus         2 ~~C~fcG~~I~pg~G~~~vr~Dgkv~~Fcs~KC~~   36 (52)
T PRK00807          2 RTCSFCGKEIEPGTGKMYVKKDGTILYFCSSKCEK   36 (52)
T ss_pred             cccCCCCCeEcCCCCeEEEEeCCcEEEEeCHHHHH
Confidence            46777876665          3  48899999974


No 25 
>PF04945 YHS:  YHS domain;  InterPro: IPR007029 This short presumed domain is about 50 amino acid residues long. It often contains two cysteines that may be functionally important. This domain is found in copper transporting ATPases, some phenol hydroxylases and in a set of uncharacterised membrane proteins including Q9CNI0 from SWISSPROT. This domain is named after three of the most conserved amino acids it contains. The domain may be metal binding, possibly copper ions. This domain is duplicated in some copper transporting ATPases.; PDB: 3U52_B 2INN_A 2INP_B 1T0Q_A 2RDB_A 1T0R_A 2IND_A 1T0S_A 2INC_A 3DHI_A ....
Probab=22.48  E-value=23  Score=22.28  Aligned_cols=12  Identities=50%  Similarity=1.099  Sum_probs=10.1

Q ss_pred             CCeeecccceee
Q 031501           66 SFRFCSLGCKIV   77 (158)
Q Consensus        66 ~~~FCSL~CKv~   77 (158)
                      .|.|||-+|+-.
T Consensus        24 ~Y~FCS~~C~~~   35 (47)
T PF04945_consen   24 TYYFCSEGCKEK   35 (47)
T ss_dssp             EEEESSHHHHHH
T ss_pred             EEEEcCHHHHHH
Confidence            489999999854


No 26 
>COG0199 RpsN Ribosomal protein S14 [Translation, ribosomal structure and biogenesis]
Probab=21.34  E-value=57  Score=22.73  Aligned_cols=23  Identities=26%  Similarity=0.569  Sum_probs=14.5

Q ss_pred             cCCCCCCCCCCCCCccccccccc
Q 031501           41 NERPQPRPGKGVTNTCEVCDRSL   63 (158)
Q Consensus        41 n~RPq~r~~~g~~~~C~~C~R~L   63 (158)
                      +.-|.++...-..|.|+.|+|.-
T Consensus         9 ~~~p~~~~~~r~~nRC~~cGRpr   31 (61)
T COG0199           9 KALPRPKSPGRGRNRCRRCGRPR   31 (61)
T ss_pred             hcCCCCCccccccccccccCCCc
Confidence            33444444334579999999753


Done!