Citrus Sinensis ID: 031505


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MDTDLYQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRRPLFPGNDHVHQMRLLIEMLIWGLSVMRMQKDIYDNFPNILVNR
cccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccHHHccccccHHHHccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccHHHHHHHcccHHHHHccc
MDTDLYQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRRPLFPGNDHVHQMRLLIEMLIWGLSVMRMQKDIYDNFPNILV**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDTDLYQIIRSNQSLSEEHCQYFLYQLLRGLKYIHSANVIHRDLKPSNLLLNANCDLKICDFGLARPTSENEFMTEYVVTRWYRAPELLLNSSDYTAAIDVWSVGCIFMELMNRRPLFPGNDHVHQMRLLIEMLIWGLSVMRMQKDIYDNFPNILVNR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitogen-activated protein kinase 3 Involved in oxidative stress-mediated signaling cascade to oxidative (such as ozone). Involved in the innate immune MAP kinase signaling cascade (MEKK1, MKK4/MKK5 and MPK3/MPK6) downstream of bacterial flagellin receptor FLS2. May be involved in hypersensitive response (HR)-mediated signaling cascade. May phosphorylate regulators of WRKY transcription factors. Mediates the phosphorylation of VIP1 and subsequent stress genes transcription in response to Agrobacterium.probableQ39023
Mitogen-activated protein kinase 1 Involved in sphingolipid elicitor (SE)-dependent defense signaling pathway. Acts downstream of heterotrimeric G protein alpha subunit and small GTPase RAC1. May regulate the expression of various genes involved in biotic and abiotic stress response.probableQ84UI5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B99, chain A
Confidence level:very confident
Coverage over the Query: 1-137
View the alignment between query and template
View the model in PyMOL
Template: 1JNK, chain A
Confidence level:confident
Coverage over the Query: 1-158
View the alignment between query and template
View the model in PyMOL