Citrus Sinensis ID: 031515

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16

MDLRSLAGFDSPFFSILEDVLELPEEQENTRNNPSRAYVRDAKAMAATPADVVEYPNSYVFVVDMPGIKASEIKVQVESENVLVVSGERKRDPKEKDNKDGVKYVRMERRFGKFMRKFVLPDNANVEKISALCQDGVLIVTVEKVPPPQPKTIQVQVA

cccccccccccccHHHHHHHHccccHHHcccccccccccccccccccccccCECcccCEEEEEEccccccccEEEEEEEccEEEEEEECccccccccccccccEEEEEEcccEEEEEEEccccccccccEEEEcccEEEEECcccccccccEEEEEEc

********FDSPFFSILEDVLELPEE*******PSRAYVRDAKAMAATPADVVEYPNSYVFVVDMPGIKASEIKVQVESENVLV*****************VKYVRMERRFGKFMRKFVLPDNANVEKISALCQDGVLIVTVE*********IQVQV*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDLRSLAGFDSPFFSILEDVLELPEEQENTRNNPSRAYVRDAKAMAATPADVVEYPNSYVFVVDMPGIKASEIKVQVESENVLVVSGERKRDPKEKDNKDGVKYVRMERRFGKFMRKFVLPDNANVEKISALCQDGVLIVTVEKVPPPQPKTIQVQVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
17.7 kDa class II heat shock protein		confident	O81822
18.0 kDa class II heat shock protein		probable	Q5VRY1
17.6 kDa class II heat shock protein		probable	P29830

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GME, chain A
Confidence level:very confident
Coverage over the Query: 43-156
View the alignment between query and template
View the model in PyMOL