Citrus Sinensis ID: 031546


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MGLASMPSASEGMLCLILMNTAMSISIVKGIFRSILKVVGFQLADSSSPPYSYFASPQVVSAEPYDVNLSPPLSYVEEFRNQNPAIKYETLLHCEDAEHDCSVCLTEFEPQSDINNLSCGHLFHKVCLEKWLDYLNVTCPLCRTPLIPEFEDDPSCFW
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHcccEEEccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccc
ccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHcccEEHHHHccccccccccEEEEccccccccEEEccccccccHHHHHHHHHccccccccccccccccccccccccc
mglasmpsaseGMLCLILMNTAMSISIVKGIFRSILKVVGFqladsssppysyfaspqvvsaepydvnlspplsyveefrnqnpaikyetllhcedaehdcsvcltefepqsdinnlscghlFHKVCLEKWLDYLnvtcplcrtplipefeddpscfw
mglasmpsaSEGMLCLILMNTAMSISIVKGIFRSILKVVGFQLADSSSPPYSYFASPQVVSAEPYDVNLSPPLSYVEEFRNQNPAIKYETLLHCEDAEHDCSVCLTEFEPQSDINNLSCGHLFHKVCLEKWLDYLNVTCPLCRTplipefeddpscfw
MGLASMPSASEGMLCLILMNTAMSISIVKGIFRSILKVVGFQLADsssppysyFASPQVVSAEPYDVNLSPPLSYVEEFRNQNPAIKYETLLHCEDAEHDCSVCLTEFEPQSDINNLSCGHLFHKVCLEKWLDYLNVTCPLCRTPLIPEFEDDPSCFW
************MLCLILMNTAMSISIVKGIFRSILKVVGFQLADSS*PPYSYFASPQVVSAEPYDVNLSPPLSYVEEFRNQNPAIKYETLLHCEDAEHDCSVCLTEFEPQSDINNLSCGHLFHKVCLEKWLDYLNVTCPLCRTPLIPEF********
*******SASEGMLCLILMNTAMSISIVKGIFRSILKVVGFQLADS************************************NPAI**********AEHDCSVCLTEFEPQSDINNLSCGHLFHKVCLEKWLDYLNVTCPLCRTPLI*********FW
********ASEGMLCLILMNTAMSISIVKGIFRSILKVVGFQLADSSSPPYSYFASPQVVSAEPYDVNLSPPLSYVEEFRNQNPAIKYETLLHCEDAEHDCSVCLTEFEPQSDINNLSCGHLFHKVCLEKWLDYLNVTCPLCRTPLIPEFEDDPSCFW
****SMPSASEGMLCLILMNTAMSISIVKGIFRSILKVVGFQLA**************************PPLSYVEEFRNQNPAIKYETLLHCEDAEHDCSVCLTEFEPQSDINNLSCGHLFHKVCLEKWLDYLNVTCPLCRTPLIPE*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLASMPSASEGMLCLILMNTAMSISIVKGIFRSILKVVGFQLADSSSPPYSYFASPQVVSAEPYDVNLSPPLSYVEEFRNQNPAIKYETLLHCEDAEHDCSVCLTEFEPQSDINNLSCGHLFHKVCLEKWLDYLNVTCPLCRTPLIPEFEDDPSCFW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query158 2.2.26 [Sep-21-2011]
Q9ZU51147 Probable E3 ubiquitin-pro no no 0.506 0.544 0.397 1e-12
Q9ZT50155 E3 ubiquitin-protein liga no no 0.316 0.322 0.48 1e-09
Q9SUS5157 E3 ubiquitin-protein liga no no 0.772 0.777 0.305 2e-09
Q8LDB8381 E3 ubiquitin-protein liga no no 0.322 0.133 0.462 4e-08
Q9LN71408 E3 ubiquitin-protein liga no no 0.348 0.134 0.474 5e-08
Q9SN28236 RING-H2 finger protein AT no no 0.525 0.351 0.363 5e-08
Q9SN27225 E3 ubiquitin-protein liga no no 0.525 0.368 0.363 6e-08
Q9SUS4159 RING-H2 zinc finger prote no no 0.405 0.402 0.382 9e-08
Q9FGJ6166 RING-H2 finger protein AT no no 0.455 0.433 0.378 1e-07
Q9NVW2624 E3 ubiquitin-protein liga yes no 0.322 0.081 0.403 4e-07
>sp|Q9ZU51|RHA2B_ARATH Probable E3 ubiquitin-protein ligase RHA2B OS=Arabidopsis thaliana GN=RHA2B PE=1 SV=2 Back     alignment and function desciption
 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/83 (39%), Positives = 49/83 (59%), Gaps = 3/83 (3%)

Query: 67  VNLSPPLSYVEEFRNQNPAIKYETLLHCEDAEHDCSVCLTEFEPQSDINNLSCGHLFHKV 126
           V ++  LS + +  N N    Y    + ++A  DC VCL++ +   ++  L C H+FHK 
Sbjct: 43  VVVTSNLSVLADQLNLNRLFSYR---YSDNAASDCIVCLSKLKTGEEVRKLDCRHVFHKQ 99

Query: 127 CLEKWLDYLNVTCPLCRTPLIPE 149
           CLE WL +LN  CPLCR+PL+P 
Sbjct: 100 CLEGWLQHLNFNCPLCRSPLLPH 122





Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q9ZT50|RHA2A_ARATH E3 ubiquitin-protein ligase RHA2A OS=Arabidopsis thaliana GN=RHA2A PE=1 SV=1 Back     alignment and function description
>sp|Q9SUS5|RHA1B_ARATH E3 ubiquitin-protein ligase RHA1B OS=Arabidopsis thaliana GN=RHA1B PE=2 SV=1 Back     alignment and function description
>sp|Q8LDB8|RING2_ARATH E3 ubiquitin-protein ligase At1g63170 OS=Arabidopsis thaliana GN=At1g63170 PE=2 SV=2 Back     alignment and function description
>sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=2 SV=1 Back     alignment and function description
>sp|Q9SN28|ATL7_ARATH RING-H2 finger protein ATL7 OS=Arabidopsis thaliana GN=ATL7 PE=2 SV=1 Back     alignment and function description
>sp|Q9SN27|ATL59_ARATH E3 ubiquitin-protein ligase ATL59 OS=Arabidopsis thaliana GN=ATL59 PE=1 SV=1 Back     alignment and function description
>sp|Q9SUS4|RHA1A_ARATH RING-H2 zinc finger protein RHA1a OS=Arabidopsis thaliana GN=RHA1A PE=2 SV=1 Back     alignment and function description
>sp|Q9FGJ6|ATL79_ARATH RING-H2 finger protein ATL79 OS=Arabidopsis thaliana GN=ATL79 PE=2 SV=1 Back     alignment and function description
>sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
76446335158 RING-H2 finger protein [Citrus trifoliat 1.0 1.0 0.981 2e-85
224131904153 predicted protein [Populus trichocarpa] 0.968 1.0 0.613 2e-47
147843500223 hypothetical protein VITISV_037474 [Viti 0.955 0.677 0.569 4e-46
225447484151 PREDICTED: E3 ubiquitin-protein ligase R 0.955 1.0 0.569 8e-46
255586512156 RING-H2 finger protein ATL3J, putative [ 0.974 0.987 0.581 2e-45
358249140155 uncharacterized protein LOC100786803 [Gl 0.974 0.993 0.579 1e-44
217071670155 unknown [Medicago truncatula] gi|3885192 0.968 0.987 0.593 3e-44
449444454155 PREDICTED: E3 ubiquitin-protein ligase R 0.981 1.0 0.601 7e-44
351720999154 uncharacterized protein LOC100305532 [Gl 0.968 0.993 0.566 2e-43
388494236154 unknown [Lotus japonicus] 0.962 0.987 0.568 3e-43
>gi|76446335|gb|ABA42952.1| RING-H2 finger protein [Citrus trifoliata] Back     alignment and taxonomy information
 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 155/158 (98%), Positives = 156/158 (98%)

Query: 1   MGLASMPSASEGMLCLILMNTAMSISIVKGIFRSILKVVGFQLADSSSPPYSYFASPQVV 60
           MGLASMPSASEGMLCLILMNTAM ISIVKGIFRSILKVVGFQLA+SSS PYSYFASPQVV
Sbjct: 1   MGLASMPSASEGMLCLILMNTAMPISIVKGIFRSILKVVGFQLAESSSTPYSYFASPQVV 60

Query: 61  SAEPYDVNLSPPLSYVEEFRNQNPAIKYETLLHCEDAEHDCSVCLTEFEPQSDINNLSCG 120
           SAEPYDVNLSPPLSYVEEFRNQNPAIKYETLLHCEDAEHDCSVCLTEFEPQSDINNLSCG
Sbjct: 61  SAEPYDVNLSPPLSYVEEFRNQNPAIKYETLLHCEDAEHDCSVCLTEFEPQSDINNLSCG 120

Query: 121 HLFHKVCLEKWLDYLNVTCPLCRTPLIPEFEDDPSCFW 158
           HLFHKVCLEKWLDYLNVTCPLCRTPLIPEFEDDPSCFW
Sbjct: 121 HLFHKVCLEKWLDYLNVTCPLCRTPLIPEFEDDPSCFW 158




Source: Citrus trifoliata

Species: Citrus trifoliata

Genus: Citrus

Family: Rutaceae

Order: Sapindales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224131904|ref|XP_002321207.1| predicted protein [Populus trichocarpa] gi|222861980|gb|EEE99522.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|147843500|emb|CAN82068.1| hypothetical protein VITISV_037474 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225447484|ref|XP_002264718.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B [Vitis vinifera] Back     alignment and taxonomy information
>gi|255586512|ref|XP_002533895.1| RING-H2 finger protein ATL3J, putative [Ricinus communis] gi|223526146|gb|EEF28485.1| RING-H2 finger protein ATL3J, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|358249140|ref|NP_001240255.1| uncharacterized protein LOC100786803 [Glycine max] gi|255639664|gb|ACU20126.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|217071670|gb|ACJ84195.1| unknown [Medicago truncatula] gi|388519267|gb|AFK47695.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|449444454|ref|XP_004139989.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like isoform 1 [Cucumis sativus] gi|449444456|ref|XP_004139990.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like isoform 2 [Cucumis sativus] gi|449444458|ref|XP_004139991.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like isoform 3 [Cucumis sativus] gi|449475654|ref|XP_004154514.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like isoform 1 [Cucumis sativus] gi|449475656|ref|XP_004154515.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like isoform 2 [Cucumis sativus] gi|449475659|ref|XP_004154516.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like isoform 3 [Cucumis sativus] Back     alignment and taxonomy information
>gi|351720999|ref|NP_001236683.1| uncharacterized protein LOC100305532 [Glycine max] gi|255625823|gb|ACU13256.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388494236|gb|AFK35184.1| unknown [Lotus japonicus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
TAIR|locus:2059793162 XERICO [Arabidopsis thaliana ( 1.0 0.975 0.524 1.2e-42
TAIR|locus:2082757170 BRH1 "brassinosteroid-responsi 0.417 0.388 0.485 3.3e-15
TAIR|locus:4515102735133 AT1G67856 [Arabidopsis thalian 0.835 0.992 0.306 1.4e-14
TAIR|locus:2038766147 RHA2B "RING-H2 finger protein 0.531 0.571 0.397 4.9e-14
TAIR|locus:2102311167 AT3G43430 [Arabidopsis thalian 0.753 0.712 0.315 3.1e-12
TAIR|locus:505006414126 AT4G00305 [Arabidopsis thalian 0.424 0.531 0.367 3.9e-12
TAIR|locus:2128293157 RHA1B "RING-H2 finger A1B" [Ar 0.436 0.439 0.397 1e-11
ASPGD|ASPL0000044927238 AN1658 [Emericella nidulans (t 0.518 0.344 0.317 1.3e-11
TAIR|locus:1006230720113 AT1G24580 [Arabidopsis thalian 0.708 0.991 0.302 1.3e-11
TAIR|locus:2195498166 AT1G63840 [Arabidopsis thalian 0.810 0.771 0.298 1.7e-11
TAIR|locus:2059793 XERICO [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 451 (163.8 bits), Expect = 1.2e-42, P = 1.2e-42
 Identities = 85/162 (52%), Positives = 113/162 (69%)

Query:     1 MGLASMPSASEGMLCLILMNTAMSISIVKGIFRSILKVVGFQLADXXXXXXXXFASPQVV 60
             MGL+S+P  SEGMLC+IL+NTA+SISIVKGI RS L +VG  L+           S +  
Sbjct:     1 MGLSSLPGPSEGMLCVILVNTALSISIVKGIVRSFLGIVGISLSPSSSSPSSVTVSSENS 60

Query:    61 S-AEPYDVNLSPPLSYVEEFRNQNPAIKYETLLHCE-DAEHDCSVCLTEFEPQSDINNLS 118
             S +E +D  +  P SY+EEFRN+ P +++E+L  C+  A+++CSVCL++F+  S+IN L 
Sbjct:    61 STSESFDFRVCQPESYLEEFRNRTPTLRFESLCRCKKQADNECSVCLSKFQGDSEINKLK 120

Query:   119 CGHLFHKVCLEKWLDYLNVTCPLCRTPLI--PEFEDDPSCFW 158
             CGHLFHK CLEKW+DY N+TCPLCRTPL+  PE     S  W
Sbjct:   121 CGHLFHKTCLEKWIDYWNITCPLCRTPLVVVPEDHQLSSNVW 162




GO:0008270 "zinc ion binding" evidence=IEA;ISS
GO:0005515 "protein binding" evidence=IPI
GO:0006970 "response to osmotic stress" evidence=IEP
GO:0009651 "response to salt stress" evidence=IEP
GO:0010200 "response to chitin" evidence=IEP
GO:0009687 "abscisic acid metabolic process" evidence=IMP
GO:0009739 "response to gibberellin stimulus" evidence=IEP
TAIR|locus:2082757 BRH1 "brassinosteroid-responsive RING-H2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4515102735 AT1G67856 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2038766 RHA2B "RING-H2 finger protein 2B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2102311 AT3G43430 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006414 AT4G00305 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2128293 RHA1B "RING-H2 finger A1B" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000044927 AN1658 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:1006230720 AT1G24580 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2195498 AT1G63840 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 4e-12
cd0016245 cd00162, RING, RING-finger (Really Interesting New 7e-11
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 6e-09
smart0018440 smart00184, RING, Ring finger 2e-07
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 2e-07
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 6e-06
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 4e-05
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 5e-04
pfam1179370 pfam11793, FANCL_C, FANCL C-terminal domain 0.001
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 0.003
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
 Score = 57.4 bits (139), Expect = 4e-12
 Identities = 26/47 (55%), Positives = 33/47 (70%), Gaps = 1/47 (2%)

Query: 99  HDCSVCLTEFEPQSDINNLSCGHLFHKVCLEKWLDYLNVTCPLCRTP 145
            +C +CL EFEP  ++  L CGH+FHK CL+KWL   + TCPLCR P
Sbjct: 1   DECPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRS-SNTCPLCRAP 46


Length = 46

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|204746 pfam11793, FANCL_C, FANCL C-terminal domain Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 158
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 99.76
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.57
PHA02929238 N1R/p28-like protein; Provisional 99.35
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.34
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.31
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.25
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.15
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.11
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.11
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.05
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.03
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 98.99
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.99
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.97
KOG0802 543 consensus E3 ubiquitin ligase [Posttranslational m 98.92
KOG0823 230 consensus Predicted E3 ubiquitin ligase [Posttrans 98.92
PF1463444 zf-RING_5: zinc-RING finger domain 98.9
PHA02926242 zinc finger-like protein; Provisional 98.9
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.88
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.86
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.81
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.7
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.69
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.58
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.52
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 98.52
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.49
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 98.46
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.45
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 98.39
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.38
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 98.37
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.37
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.32
KOG149384 consensus Anaphase-promoting complex (APC), subuni 98.29
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 98.27
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.23
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.17
KOG1785 563 consensus Tyrosine kinase negative regulator CBL [ 98.15
COG52191525 Uncharacterized conserved protein, contains RING Z 98.12
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 98.04
KOG1039 344 consensus Predicted E3 ubiquitin ligase [Posttrans 98.0
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 98.0
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 97.86
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.8
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 97.76
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 97.72
KOG4445 368 consensus Uncharacterized conserved protein, conta 97.65
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.65
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.63
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.51
KOG3970 299 consensus Predicted E3 ubiquitin ligase [Posttrans 97.35
KOG1941518 consensus Acetylcholine receptor-associated protei 97.34
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.3
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.25
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.17
KOG1814 445 consensus Predicted E3 ubiquitin ligase [Posttrans 96.88
KOG1002 791 consensus Nucleotide excision repair protein RAD16 96.85
COG5152259 Uncharacterized conserved protein, contains RING a 96.71
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 96.71
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.7
KOG1428 3738 consensus Inhibitor of type V adenylyl cyclases/Ne 96.61
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 96.61
PHA02862156 5L protein; Provisional 96.6
KOG2660 331 consensus Locus-specific chromosome binding protei 96.54
PHA02825162 LAP/PHD finger-like protein; Provisional 96.54
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.49
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.46
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 96.42
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 96.32
KOG4185 296 consensus Predicted E3 ubiquitin ligase [Posttrans 96.24
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 96.23
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.04
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 95.96
KOG4739 233 consensus Uncharacterized protein involved in syna 95.92
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 95.92
PF10272358 Tmpp129: Putative transmembrane protein precursor; 95.83
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 95.75
PHA03096284 p28-like protein; Provisional 95.7
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.66
COG5222427 Uncharacterized conserved protein, contains RING Z 95.5
KOG0801205 consensus Predicted E3 ubiquitin ligase [Posttrans 95.44
COG5175 480 MOT2 Transcriptional repressor [Transcription] 95.18
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 95.05
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 95.02
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 94.83
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 94.74
PF04641260 Rtf2: Rtf2 RING-finger 94.73
KOG1940276 consensus Zn-finger protein [General function pred 94.57
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 94.3
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 94.21
KOG3039303 consensus Uncharacterized conserved protein [Funct 93.9
KOG1001 674 consensus Helicase-like transcription factor HLTF/ 93.68
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 93.53
KOG3053 293 consensus Uncharacterized conserved protein [Funct 93.26
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 93.26
KOG3800 300 consensus Predicted E3 ubiquitin ligase containing 93.11
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 92.65
KOG4367 699 consensus Predicted Zn-finger protein [Function un 91.76
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 91.35
KOG1609 323 consensus Protein involved in mRNA turnover and st 90.96
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 90.78
KOG3002 299 consensus Zn finger protein [General function pred 90.4
KOG3899381 consensus Uncharacterized conserved protein [Funct 90.22
KOG03091081 consensus Conserved WD40 repeat-containing protein 90.11
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 88.67
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 85.76
KOG0298 1394 consensus DEAD box-containing helicase-like transc 84.13
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 83.21
COG5109396 Uncharacterized conserved protein, contains RING Z 83.03
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 82.07
KOG1812 384 consensus Predicted E3 ubiquitin ligase [Posttrans 81.48
KOG0269839 consensus WD40 repeat-containing protein [Function 80.67
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.76  E-value=3.4e-18  Score=136.71  Aligned_cols=77  Identities=21%  Similarity=0.603  Sum_probs=64.9

Q ss_pred             cchHHHHHhhCCcceeeccccCCCCCcccccccccccCCCCeEEeCCCChhhHhhHHHHHhcCCCCCccccCcCCCCC
Q 031546           73 LSYVEEFRNQNPAIKYETLLHCEDAEHDCSVCLTEFEPQSDINNLSCGHLFHKVCLEKWLDYLNVTCPLCRTPLIPEF  150 (158)
Q Consensus        73 ~~~~~~~~~~lp~~~~~~~~~~~~~~~~C~iCl~~~~~~~~~~~l~C~H~fh~~Ci~~w~~~~~~~CP~Cr~~~~~~~  150 (158)
                      .++.+...+++|...|....+.... ..|+||+|+|++|+++|.|||+|.||..||++|+...+..||+|++.+....
T Consensus       205 ~r~~k~~l~~~p~~~f~~~~~~~~~-~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~r~~CPvCK~di~~~~  281 (348)
T KOG4628|consen  205 NRLIKRLLKKLPVRTFTKGDDEDAT-DTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQTRTFCPVCKRDIRTDS  281 (348)
T ss_pred             hhhHHHHHhhCCcEEeccccccCCC-ceEEEeecccccCCeeeEecCCCchhhccchhhHhhcCccCCCCCCcCCCCC
Confidence            3566788889999999887544444 6999999999999999999999999999999999854566999999876543



>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0801 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1609 consensus Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0309 consensus Conserved WD40 repeat-containing protein [Function unknown] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0269 consensus WD40 repeat-containing protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 8e-07
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 1e-06
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 1e-05
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 9e-05
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 9e-04
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure

Iteration: 1

Score = 49.3 bits (116), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 21/47 (44%), Positives = 31/47 (65%), Gaps = 1/47 (2%) Query: 101 CSVCLTEFEPQSDINNLSCGHLFHKVCLEKWLDYLNVTCPLCRTPLI 147 C+VCL +F+P+ ++ C H FH+ CL KWL+ V CPLC P++ Sbjct: 18 CAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKV-CPLCNMPVL 63
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 7e-16
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-15
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 2e-15
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 2e-15
2ect_A78 Ring finger protein 126; metal binding protein, st 3e-14
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 2e-13
2ecm_A55 Ring finger and CHY zinc finger domain- containing 4e-12
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 3e-11
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 7e-11
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-10
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 5e-10
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 1e-09
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 1e-09
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 4e-09
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 9e-09
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 2e-08
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 3e-08
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 5e-08
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 6e-08
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 8e-08
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-07
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 2e-07
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 3e-07
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 5e-07
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 5e-07
1z6u_A150 NP95-like ring finger protein isoform B; structura 1e-06
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 3e-06
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 7e-06
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 7e-06
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 7e-06
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 8e-06
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 6e-04
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 1e-05
3nw0_A238 Non-structural maintenance of chromosomes element 1e-05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 2e-05
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 2e-05
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 2e-05
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 3e-05
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 5e-05
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 8e-05
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 1e-04
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 2e-04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 3e-04
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 5e-04
2ysl_A73 Tripartite motif-containing protein 31; ring-type 8e-04
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 67.4 bits (165), Expect = 7e-16
 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 2/65 (3%)

Query: 84  PAIKYETLLHCEDAEHDCSVCLTEFEPQSDINNLSCGHLFHKVCLEKWLDYLNVTCPLCR 143
           P+ ++    H  +    C VC+ +FE +  +  L C H FH  C++KWL   N TCP+CR
Sbjct: 10  PSYRFNPNNHQSEQT-LCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWL-KANRTCPICR 67

Query: 144 TPLIP 148
               P
Sbjct: 68  ADSGP 72


>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.74
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.64
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.61
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.58
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.58
2ect_A78 Ring finger protein 126; metal binding protein, st 99.57
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.51
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.48
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.48
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.45
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.43
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.42
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.42
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.42
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.41
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.4
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.4
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.39
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.37
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.37
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.36
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.35
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.35
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.34
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.34
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.33
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.31
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.28
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.28
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.28
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.27
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.27
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.26
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.25
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.25
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.25
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.24
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.23
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.23
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.2
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.19
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.18
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.17
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.17
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.16
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.14
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.13
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.12
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.12
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.08
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.05
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.04
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.04
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.02
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.98
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.97
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.95
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.94
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.93
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.85
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.79
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.79
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.77
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.75
2ea5_A68 Cell growth regulator with ring finger domain prot 98.74
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.63
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.59
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.49
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.45
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.44
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.38
3nw0_A238 Non-structural maintenance of chromosomes element 97.69
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.07
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 93.61
1we9_A64 PHD finger family protein; structural genomics, PH 93.0
3lqh_A 183 Histone-lysine N-methyltransferase MLL; PHD finger 87.58
2k16_A75 Transcription initiation factor TFIID subunit 3; p 87.35
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 86.9
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 86.33
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 84.71
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 84.23
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 83.41
1wem_A76 Death associated transcription factor 1; structura 81.88
2ri7_A 174 Nucleosome-remodeling factor subunit BPTF; zinc fi 81.01
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 80.41
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.74  E-value=4.1e-18  Score=112.38  Aligned_cols=79  Identities=28%  Similarity=0.526  Sum_probs=68.2

Q ss_pred             CCCcchHHHHHhhCCcceeeccccCCCCCcccccccccccCCCCeEEeCCCChhhHhhHHHHHhcCCCCCccccCcCCCC
Q 031546           70 SPPLSYVEEFRNQNPAIKYETLLHCEDAEHDCSVCLTEFEPQSDINNLSCGHLFHKVCLEKWLDYLNVTCPLCRTPLIPE  149 (158)
Q Consensus        70 ~~~~~~~~~~~~~lp~~~~~~~~~~~~~~~~C~iCl~~~~~~~~~~~l~C~H~fh~~Ci~~w~~~~~~~CP~Cr~~~~~~  149 (158)
                      ....+++++.++.+|...+.......+.+..|+||++.+..++.++.++|+|.||..||.+|++ .+.+||+||+.+.+.
T Consensus        12 ~~~~~~s~~~i~~lp~~~~~~~~~~~~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~-~~~~CP~Cr~~~~~~   90 (91)
T 2l0b_A           12 VANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQ-KSGTCPVCRCMFPPP   90 (91)
T ss_dssp             SCCCCCCHHHHHTSCEEECCTTCSSSSSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHT-TTCBCTTTCCBSSCC
T ss_pred             cCCCCCCHHHHHhCCCeeecccccccCCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHH-cCCcCcCcCccCCCC
Confidence            3456788899999999998876555667789999999998888899999999999999999998 588999999988653



>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 158
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-11
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-10
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-09
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 4e-09
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-08
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 5e-08
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 7e-08
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-07
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 3e-07
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 4e-07
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 2e-06
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 6e-06
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 1e-04
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
 Score = 53.7 bits (129), Expect = 2e-11
 Identities = 22/53 (41%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 96  DAEHDCSVCLTEFEPQSDINNL-SCGHLFHKVCLEKWLDYLNVTCPLCRTPLI 147
           D   +C+VCL E E   +   L  CGH FH  C++ WL   + TCPLCR  ++
Sbjct: 3   DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGS-HSTCPLCRLTVV 54


>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.69
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.54
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.53
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.49
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.47
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.45
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.4
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.3
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.28
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.25
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.2
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.18
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.15
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.01
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.79
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.53
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 93.22
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 90.06
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 89.83
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 89.16
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 88.13
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 86.11
d1wema_76 Death associated transcription factor 1, Datf1 (DI 81.33
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]
Probab=99.69  E-value=4.8e-18  Score=100.53  Aligned_cols=51  Identities=43%  Similarity=1.009  Sum_probs=45.5

Q ss_pred             CCCcccccccccccCCCCeEEeC-CCChhhHhhHHHHHhcCCCCCccccCcCC
Q 031546           96 DAEHDCSVCLTEFEPQSDINNLS-CGHLFHKVCLEKWLDYLNVTCPLCRTPLI  147 (158)
Q Consensus        96 ~~~~~C~iCl~~~~~~~~~~~l~-C~H~fh~~Ci~~w~~~~~~~CP~Cr~~~~  147 (158)
                      +++.+|+||+++|.+++.++.++ |+|.||..|+++|++ .+.+||+||+++.
T Consensus         3 ed~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~-~~~~CP~CR~~i~   54 (55)
T d1iyma_           3 DDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLG-SHSTCPLCRLTVV   54 (55)
T ss_dssp             CCSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTT-TCCSCSSSCCCSC
T ss_pred             CCCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHH-hCCcCCCCCCEeE
Confidence            45568999999999888888875 999999999999998 5889999999875



>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure