Query 031555
Match_columns 157
No_of_seqs 60 out of 62
Neff 3.3
Searched_HMMs 46136
Date Fri Mar 29 15:46:49 2013
Command hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031555.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/031555hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 PF07145 PAM2: Ataxin-2 C-term 97.8 9E-06 2E-10 45.1 1.5 15 7-21 3-17 (18)
2 PF15228 DAP: Death-associated 82.2 0.98 2.1E-05 33.8 1.9 29 129-157 65-96 (97)
3 KOG4163 Prolyl-tRNA synthetase 35.6 13 0.00029 35.5 0.2 21 11-31 119-144 (551)
4 PF07110 EthD: EthD domain; I 19.1 54 0.0012 21.9 0.8 14 39-52 5-18 (95)
5 PF02371 Transposase_20: Trans 16.4 89 0.0019 21.8 1.4 14 33-46 73-86 (87)
6 COG4189 Predicted transcriptio 14.8 59 0.0013 29.2 0.2 32 7-38 186-232 (308)
7 TIGR02118 conserved hypothetic 13.6 99 0.0021 21.8 1.0 14 39-52 13-26 (100)
8 COG3433 Aryl carrier domain [S 12.8 99 0.0021 22.7 0.8 10 30-39 60-69 (74)
9 KOG0986 G protein-coupled rece 12.7 88 0.0019 30.5 0.7 22 24-45 361-389 (591)
10 PF13891 zf-C3Hc3H: Potential 12.2 1.1E+02 0.0024 20.8 0.9 14 9-22 25-38 (65)
No 1
>PF07145 PAM2: Ataxin-2 C-terminal region; InterPro: IPR009818 This entry represents a conserved region approximately 250 residues long located towards the C terminus of eukaryotic ataxin-2. Ataxin-2 is a protein of unknown function, within which expansion of a polyglutamine tract (due to expansion of unstable CAG repeats in the coding region of the SCA2 gene) causes spinocerebellar ataxia type 2 (SCA2), a late-onset neurodegenerative disorder []. The expanded polyglutamine repeat in ataxin-2 causes disruption of the normal morphology of the Golgi complex and increased incidence of cell death []. Ataxin-2 is predicted to consist of mostly non-globular domains [].; PDB: 3NTW_B 1JH4_B 3KTR_B 3KUJ_B 3KUT_D 3KUS_D 1JGN_B 2RQG_A 2RQH_A.
Probab=97.83 E-value=9e-06 Score=45.14 Aligned_cols=15 Identities=60% Similarity=1.074 Sum_probs=12.7
Q ss_pred CCCCCCCCCccccch
Q 031555 7 RSTLNPNAPLFIPAA 21 (157)
Q Consensus 7 ~StLNPnAplFiPaa 21 (157)
.|+||||||.|||..
T Consensus 3 ~s~LNp~A~eFvP~~ 17 (18)
T PF07145_consen 3 SSKLNPNAPEFVPSS 17 (18)
T ss_dssp SSSSSTTSSSS-TTT
T ss_pred ccccCCCCccccCCC
Confidence 699999999999974
No 2
>PF15228 DAP: Death-associated protein
Probab=82.17 E-value=0.98 Score=33.81 Aligned_cols=29 Identities=34% Similarity=0.391 Sum_probs=22.6
Q ss_pred CchhhcccccCCCcccCCCCCCC---ccCCCC
Q 031555 129 SSMEAAKYVEKPAKYVNPKCSPR---RIQQPR 157 (157)
Q Consensus 129 ~~~e~pky~EKp~k~v~~k~spR---~IhQPR 157 (157)
.+..+..|.+||.=-+..+.++| .|||||
T Consensus 65 P~~AvqvaHqKP~P~~ek~~~~~~~~~IqQPR 96 (97)
T PF15228_consen 65 PPEAVQVAHQKPRPAVEKPPPPRRINIIQQPR 96 (97)
T ss_pred cHHHHHHhhcCCCccccCcCCCCCCccccCCC
Confidence 34666677899998888887776 379999
No 3
>KOG4163 consensus Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=35.58 E-value=13 Score=35.50 Aligned_cols=21 Identities=38% Similarity=0.700 Sum_probs=17.5
Q ss_pred CCCCCccccchhh-----hccCCChH
Q 031555 11 NPNAPLFIPAAFR-----QVEDFSPE 31 (157)
Q Consensus 11 NPnAplFiPaa~r-----~VEDFSpe 31 (157)
|=--|+|||-++- -||+|+||
T Consensus 119 ncYFPmfVs~~~LEkEk~Hve~FaPE 144 (551)
T KOG4163|consen 119 NCYFPMFVSKSVLEKEKDHVEGFAPE 144 (551)
T ss_pred cceeeeecCHHHHhhhhhhhccCCcc
Confidence 4456999999887 58999998
No 4
>PF07110 EthD: EthD domain; InterPro: IPR009799 This family consists of several bacterial sequences which are related to the EthD protein of Rhodococcus ruber (Q93EX2 from SWISSPROT). R. ruber (formerly Gordonia terrae) IFP 2001 is one of a few bacterial strains able to degrade ethyl tert-butyl ether (ETBE), which is a major pollutant from gasoline. This strain was found to undergo a spontaneous 14.3-kbp chromosomal deletion, which results in the loss of the ability to degrade ETBE. Sequence analysis of the region corresponding to the deletion revealed the presence of a gene cluster, ethABCD, encoding a ferredoxin reductase (EthA), a cytochrome P-450 (EthB), a ferredoxin (EthC), and a 10kDa protein of unknown function (EthD), respectively. Upstream of ethABCD lies ethR, which codes for a putative positive transcriptional regulator of the AraC/XylS family. Transformation of the ETBE-negative mutant by a plasmid carrying the ethRABCD genes restored the ability to degrade ETBE. Complementation was abolished if the plasmid carried ethRABC only demonstrating that EthD is essential for the ETBE degradation system [].; PDB: 3BF4_B 2FTR_A.
Probab=19.11 E-value=54 Score=21.91 Aligned_cols=14 Identities=29% Similarity=0.783 Sum_probs=10.3
Q ss_pred chhHHHHHHhhccC
Q 031555 39 STWYHNYWLSQHQD 52 (157)
Q Consensus 39 s~wFrd~Wl~q~~~ 52 (157)
-.=|++||...|-.
T Consensus 5 ~eeF~~~~~~~H~p 18 (95)
T PF07110_consen 5 PEEFHDYWREVHAP 18 (95)
T ss_dssp HHHHHHHHHHTHHH
T ss_pred HHHHHHHHHHhHHH
Confidence 34599999997743
No 5
>PF02371 Transposase_20: Transposase IS116/IS110/IS902 family; InterPro: IPR003346 Transposases are needed for efficient transposition of the insertion sequence or transposon DNA. This family includes transposases for IS116, IS110 and IS902. It is often found with the transposase IS111A/IS1328/IS1533 family (see IPR002525 from INTERPRO) [, ]. More information about these proteins can be found at Protein of the Month: Transposase [].; GO: 0003677 DNA binding, 0004803 transposase activity, 0006313 transposition, DNA-mediated
Probab=16.43 E-value=89 Score=21.84 Aligned_cols=14 Identities=29% Similarity=1.170 Sum_probs=11.7
Q ss_pred HHHhhcchhHHHHH
Q 031555 33 WQLITTSTWYHNYW 46 (157)
Q Consensus 33 W~LV~ts~wFrd~W 46 (157)
|.++++.+|||+||
T Consensus 73 ~~~~r~~~~~~~~Y 86 (87)
T PF02371_consen 73 WSAIRHNPWFRAYY 86 (87)
T ss_pred HHHHhhCcHHHHHh
Confidence 67788889999886
No 6
>COG4189 Predicted transcriptional regulator [Transcription]
Probab=14.82 E-value=59 Score=29.17 Aligned_cols=32 Identities=28% Similarity=0.553 Sum_probs=20.6
Q ss_pred CCCCCCCCCccccchhhhc---------------cCCChHHHHHhhc
Q 031555 7 RSTLNPNAPLFIPAAFRQV---------------EDFSPEWWQLITT 38 (157)
Q Consensus 7 ~StLNPnAplFiPaa~r~V---------------EDFSpeWW~LV~t 38 (157)
...-|-|=|-=|--++--| .-|+|.||.|+-+
T Consensus 186 ~P~Tn~nWPSDIs~~iNg~kig~WTsPgDfGDkrG~ytP~WWklsgs 232 (308)
T COG4189 186 VPGTNDNWPSDISFYINGVKIGIWTSPGDFGDKRGKYTPDWWKLSGS 232 (308)
T ss_pred CCCCCCCCCcceEEEECCEEEeeecCCcccccCCCCcCcchhhhccc
Confidence 4455666665554444433 4589999999875
No 7
>TIGR02118 conserved hypothetical protein. This model represents a small family of proteins of unknown function, each about 105 amino acids in length. Conserved sites in the multiple alignment include a pair of aromatic residues, a histidine, and an aspartate.
Probab=13.64 E-value=99 Score=21.85 Aligned_cols=14 Identities=7% Similarity=0.195 Sum_probs=11.0
Q ss_pred chhHHHHHHhhccC
Q 031555 39 STWYHNYWLSQHQD 52 (157)
Q Consensus 39 s~wFrd~Wl~q~~~ 52 (157)
-..|++||...|-.
T Consensus 13 ~e~F~~yy~~~H~p 26 (100)
T TIGR02118 13 GAAFDHHYRDTHVP 26 (100)
T ss_pred HHHHHHHHHhccHH
Confidence 46899999988843
No 8
>COG3433 Aryl carrier domain [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=12.81 E-value=99 Score=22.74 Aligned_cols=10 Identities=50% Similarity=1.398 Sum_probs=7.9
Q ss_pred hHHHHHhhcc
Q 031555 30 PEWWQLITTS 39 (157)
Q Consensus 30 peWW~LV~ts 39 (157)
..||+|+.|-
T Consensus 60 ~aW~qLl~~~ 69 (74)
T COG3433 60 AAWWQLLSTR 69 (74)
T ss_pred HHHHHHHHhc
Confidence 3799999873
No 9
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms]
Probab=12.70 E-value=88 Score=30.50 Aligned_cols=22 Identities=36% Similarity=0.803 Sum_probs=17.4
Q ss_pred hccCCChHHHHH-------hhcchhHHHH
Q 031555 24 QVEDFSPEWWQL-------ITTSTWYHNY 45 (157)
Q Consensus 24 ~VEDFSpeWW~L-------V~ts~wFrd~ 45 (157)
.|=||||.||.| +...+=||+|
T Consensus 361 e~Y~~s~Dwf~lGCllYemi~G~sPFr~~ 389 (591)
T KOG0986|consen 361 EVYDFSPDWFSLGCLLYEMIAGHSPFRQR 389 (591)
T ss_pred CcccCCccHHHHHhHHHHHHcccCchhhh
Confidence 457999999964 7777778876
No 10
>PF13891 zf-C3Hc3H: Potential DNA-binding domain
Probab=12.20 E-value=1.1e+02 Score=20.79 Aligned_cols=14 Identities=36% Similarity=0.769 Sum_probs=12.0
Q ss_pred CCCCCCCccccchh
Q 031555 9 TLNPNAPLFIPAAF 22 (157)
Q Consensus 9 tLNPnAplFiPaa~ 22 (157)
.+|||+|||.+-+|
T Consensus 25 l~D~~Q~Lf~~C~~ 38 (65)
T PF13891_consen 25 LEDPNQPLFKQCSY 38 (65)
T ss_pred ccCCCCCCcccCcC
Confidence 47999999999876
Done!