BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031556
         (157 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3OZF|A Chain A, Crystal Structure Of Plasmodium Falciparum
           Hypoxanthine-Guanine- Xanthine Phosphoribosyltransferase
           In Complex With Hypoxanthine
 pdb|3OZF|B Chain B, Crystal Structure Of Plasmodium Falciparum
           Hypoxanthine-Guanine- Xanthine Phosphoribosyltransferase
           In Complex With Hypoxanthine
 pdb|3OZF|C Chain C, Crystal Structure Of Plasmodium Falciparum
           Hypoxanthine-Guanine- Xanthine Phosphoribosyltransferase
           In Complex With Hypoxanthine
 pdb|3OZF|D Chain D, Crystal Structure Of Plasmodium Falciparum
           Hypoxanthine-Guanine- Xanthine Phosphoribosyltransferase
           In Complex With Hypoxanthine
 pdb|3OZG|A Chain A, Crystal Structure Of Plasmodium Falciparum
           Hypoxanthine-Guanine- Xanthine Phosphoribosyltransferase
           In Complex With S-Serme-Immh Phosphonate
 pdb|3OZG|B Chain B, Crystal Structure Of Plasmodium Falciparum
           Hypoxanthine-Guanine- Xanthine Phosphoribosyltransferase
           In Complex With S-Serme-Immh Phosphonate
 pdb|3OZG|C Chain C, Crystal Structure Of Plasmodium Falciparum
           Hypoxanthine-Guanine- Xanthine Phosphoribosyltransferase
           In Complex With S-Serme-Immh Phosphonate
 pdb|3OZG|D Chain D, Crystal Structure Of Plasmodium Falciparum
           Hypoxanthine-Guanine- Xanthine Phosphoribosyltransferase
           In Complex With S-Serme-Immh Phosphonate
          Length = 250

 Score = 26.6 bits (57), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 5/48 (10%)

Query: 32  NNIEKQVYDMETSYLQDPSQCGNVLKGFEGFLSSSKNTALLKRSRKFQ 79
           N IEK  YD++  Y  +      +LKG  GF      TALLK   +  
Sbjct: 71  NRIEKLAYDIKKVYNNEEFHILCLLKGSRGFF-----TALLKHLSRIH 113


>pdb|1CJB|A Chain A, Malarial Purine Phosphoribosyltransferase
 pdb|1CJB|B Chain B, Malarial Purine Phosphoribosyltransferase
 pdb|1CJB|C Chain C, Malarial Purine Phosphoribosyltransferase
 pdb|1CJB|D Chain D, Malarial Purine Phosphoribosyltransferase
          Length = 231

 Score = 26.2 bits (56), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 5/48 (10%)

Query: 32 NNIEKQVYDMETSYLQDPSQCGNVLKGFEGFLSSSKNTALLKRSRKFQ 79
          N IEK  YD++  Y  +      +LKG  GF      TALLK   +  
Sbjct: 52 NRIEKLAYDIKKVYNNEEFHILCLLKGSRGFF-----TALLKHLSRIH 94


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.309    0.128    0.353 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,410,556
Number of Sequences: 62578
Number of extensions: 104329
Number of successful extensions: 133
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 133
Number of HSP's gapped (non-prelim): 2
length of query: 157
length of database: 14,973,337
effective HSP length: 91
effective length of query: 66
effective length of database: 9,278,739
effective search space: 612396774
effective search space used: 612396774
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 47 (22.7 bits)