BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 031557
(157 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2D8M|A Chain A, Solution Structure Of The First Brct Domain Of Dna-Repair
Protein Xrcc1
Length = 129
Score = 31.6 bits (70), Expect = 0.18, Method: Compositional matrix adjust.
Identities = 13/29 (44%), Positives = 20/29 (68%)
Query: 124 IKVTLSGNQQPVRTEITEAAMELGAEVKT 152
+ V LSG Q P R+E+ + A+ELGA+ +
Sbjct: 26 VVVVLSGFQNPFRSELRDKALELGAKYRP 54
>pdb|3M9U|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase
From Lactobacillus Brevis Atcc 367
pdb|3M9U|B Chain B, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase
From Lactobacillus Brevis Atcc 367
pdb|3M9U|C Chain C, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase
From Lactobacillus Brevis Atcc 367
pdb|3M9U|D Chain D, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase
From Lactobacillus Brevis Atcc 367
pdb|3PDE|A Chain A, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase
From Lactobacillus Brevis Atcc 367 Complexed With
Isoprenyl Diphosphate And Magnesium
pdb|3PDE|B Chain B, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase
From Lactobacillus Brevis Atcc 367 Complexed With
Isoprenyl Diphosphate And Magnesium
pdb|3PDE|C Chain C, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase
From Lactobacillus Brevis Atcc 367 Complexed With
Isoprenyl Diphosphate And Magnesium
pdb|3PDE|D Chain D, Crystal Structure Of Geranylgeranyl Pyrophosphate Synthase
From Lactobacillus Brevis Atcc 367 Complexed With
Isoprenyl Diphosphate And Magnesium
Length = 309
Score = 30.0 bits (66), Expect = 0.50, Method: Compositional matrix adjust.
Identities = 16/51 (31%), Positives = 26/51 (50%)
Query: 65 KKDNNEKGDDAPSKAGILGNMQNLYETVKKAQMVVQVEAVRVQKELAAAEF 115
+KD +E + P K G++G Q L +T+ Q +Q Q++ AA F
Sbjct: 242 QKDADEAKNTYPGKLGLIGANQALIDTIHSGQAALQGLPTSTQRDDLAAFF 292
>pdb|1PUG|A Chain A, Structure Of E. Coli Ybab
pdb|1PUG|B Chain B, Structure Of E. Coli Ybab
pdb|1PUG|C Chain C, Structure Of E. Coli Ybab
pdb|1PUG|D Chain D, Structure Of E. Coli Ybab
Length = 109
Score = 28.5 bits (62), Expect = 1.6, Method: Compositional matrix adjust.
Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 4/63 (6%)
Query: 83 GNMQNLYETVKKAQMVVQVEAVRVQKELAAAEFDGYCEGELIKVTLSGNQQPVRTEITEA 142
G + NL + ++ Q +Q ++Q+E+A E G L+KVT++G R EI +
Sbjct: 5 GGLGNLMKQAQQMQEKMQ----KMQEEIAQLEVTGESGAGLVKVTINGAHNCRRVEIDPS 60
Query: 143 AME 145
+E
Sbjct: 61 LLE 63
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.312 0.126 0.345
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,666,788
Number of Sequences: 62578
Number of extensions: 121026
Number of successful extensions: 224
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 220
Number of HSP's gapped (non-prelim): 7
length of query: 157
length of database: 14,973,337
effective HSP length: 91
effective length of query: 66
effective length of database: 9,278,739
effective search space: 612396774
effective search space used: 612396774
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 47 (22.7 bits)