BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031572
         (157 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2AHO|B Chain B, Structure Of The Archaeal Initiation Factor Eif2 Alpha-
           Gamma Heterodimer From Sulfolobus Solfataricus Complexed
           With Gdpnp
 pdb|3CW2|C Chain C, Crystal Structure Of The Intact Archaeal Translation
           Initiation Factor 2 From Sulfolobus Solfataricus .
 pdb|3CW2|D Chain D, Crystal Structure Of The Intact Archaeal Translation
           Initiation Factor 2 From Sulfolobus Solfataricus .
 pdb|3CW2|G Chain G, Crystal Structure Of The Intact Archaeal Translation
           Initiation Factor 2 From Sulfolobus Solfataricus .
 pdb|3CW2|H Chain H, Crystal Structure Of The Intact Archaeal Translation
           Initiation Factor 2 From Sulfolobus Solfataricus .
 pdb|3V11|B Chain B, Structure Of The Ternary Initiation Complex
           Aif2:gdpnp:methionylated Initiator Trna
          Length = 266

 Score = 30.8 bits (68), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 18/79 (22%), Positives = 33/79 (41%)

Query: 11  CAACKCLRRKCMPDCVFAPYFPPEEPQKFVNVHKIFGASNVSKLLNEVLPHQREDAVNSL 70
               +  RRK   D         E  +K +   KI     + +L+++ L    +DA   +
Sbjct: 66  VKVIRVDRRKGTVDVSLKKVTDDERRKKNLQWKKIQRLDKILELVSQKLKLSEKDAWEQV 125

Query: 71  AYEAEARLKDPVYGCVGAI 89
           A++ EA+  DP+     A+
Sbjct: 126 AWKLEAKYGDPITAIEKAV 144


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.131    0.402 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,782,153
Number of Sequences: 62578
Number of extensions: 171754
Number of successful extensions: 311
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 309
Number of HSP's gapped (non-prelim): 2
length of query: 157
length of database: 14,973,337
effective HSP length: 91
effective length of query: 66
effective length of database: 9,278,739
effective search space: 612396774
effective search space used: 612396774
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)