Citrus Sinensis ID: 031584

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MQASRARLFKEYKEVQREKSADPDIQLVCDDSNIFKWTALIKGPSETPYEGGVFQLAFAVPEQYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGNLLRSGDIRGFQSMARMYTRLAAMPKKG
cccHHHHHHHHHHHHHcccccccccEEEEcccccCEEEEEEEccccccccccEEEEEEEccccccccccEEEECccccccccccccccEEEEcccccccHHccHHHHHHHHHHHHccccccccccHHHHHHHHHccHHHHHHHHHHHHHHHcccccc
***SRAR*FKEYKEVQREKSADPDIQLVCDDSNIFKWTALIKGPSETPYEGGVFQLAFAVPEQYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGNLLRSGDIRGFQSMARMYTRLAAMP***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQASRARLFKEYKEVQREKSADPDIQLVCDDSNIFKWTALIKGPSETPYEGGVFQLAFAVPEQYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGNLLRSGDIRGFQSMARMYTRLAAMPKKG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein PEROXIN-4 Required for peroxisome biogenesis. Necessary for the developmental elimination of obsolete peroxisome matrix proteins. May be involved in the ubiquitination of PEX5, targeting it for recycling. Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.confidentQ8LGF7
Ubiquitin-conjugating enzyme E2 pex4 Catalyzes the covalent attachment of ubiquitin to other proteins. Essential for peroxisome biogenesis.probableQ86IZ3
Ubiquitin-conjugating enzyme E2 16 Catalyzes the covalent attachment of ubiquitin to other proteins.probableQ9P6I1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PWQ, chain A
Confidence level:very confident
Coverage over the Query: 2-155
View the alignment between query and template
View the model in PyMOL