Citrus Sinensis ID: 031620

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MGWIGESIESIKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGREIPIVHRVIKVHERQDTGEVEVLTKGDNNYGDDRLLYAQGQLWLKRQHIMGRAVGFLPYVGWVTIIMTEKPIIKYILIGALGLLVITSKD
cccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccEEEEEccccccccccccCEEEEEEEEEEEECccccCEEEEEcccccccccccccccccccEEEEEEEEEEEEEEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHccc
***IGESIESIKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGREIPIVHRVIKVHERQDTGEVEVLTKGDNNYGDDRLLYAQGQLWLKRQHIMGRAVGFLPYVGWVTIIMTEKPIIKYILIGALGLLVITSK*
xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGWIGESIESIKSLQIRQVLTQGVSLGMIVTSALIIWKALMCITGSESPVVVVLSGSMEPGFKRGREIPIVHRVIKVHERQDTGEVEVLTKGDNNYGDDRLLYAQGQLWLKRQHIMGRAVGFLPYVGWVTIIMTEKPIIKYILIGALGLLVITSKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal peptidase complex catalytic subunit SEC11 Catalytic component of the signal peptidase complex (SPC), which catalyzes the cleavage of N-terminal signal sequences of proteins targeted to the endoplasmic reticulum. Signal peptide cleavage occurs during the translocation (cotranslationally or post-translationally) through the translocon pore into the endoplasmic reticulum.probableQ759W4
Signal sequence processing protein Catalytic component of the signal peptidase complex (SPC), which catalyzes the cleavage of N-terminal signal sequences of proteins targeted to the endoplasmic reticulum. Signal peptide cleavage occurs during the translocation (cotranslationally or post-translationally) through the translocon pore into the endoplasmic reticulum.probableA3LXS1
Signal peptidase complex catalytic subunit SEC11 Catalytic component of the signal peptidase complex (SPC), which catalyzes the cleavage of N-terminal signal sequences of proteins targeted to the endoplasmic reticulum. Signal peptide cleavage occurs during the translocation (cotranslationally or post-translationally) through the translocon pore into the endoplasmic reticulum.probableQ6BP15

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JHF, chain A
Confidence level:probable
Coverage over the Query: 50-125
View the alignment between query and template
View the model in PyMOL