Citrus Sinensis ID: 031641


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MEPMDIVGKSKEDASLPKATMTKIIKEMLPADVRVARDAQDLLIECCVEFINLVSSESNEVCSREDKRTIAPEHVLKALEVLGFGEYIEEVYAAYEQHKLETMDSLKGGKWSNGAEMTEEEAAAEQQRMFAEARARMNGGAAGPPKQPDINPSLES
cccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
**************SLPKATMTKIIKEMLPADVRVARDAQDLLIECCVEFINLVSSESNEVCSREDKRTIAPEHVLKALEVLGFGEYIEEVYAAYEQHKL********************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPMDIVGKSKEDASLPKATMTKIIKEMLPADVRVARDAQDLLIECCVEFINLVSSESNEVCSREDKRTIAPEHVLKALEVLGFGEYIEEVYAAYEQHKLETMDSLKGGKWSNGAEMTEEEAAAEQQRMFAEARARMNGGAAGPPKQPDINPSLES

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein Dr1 homolog confidentP49592
Protein Dr1 homolog Involved in transcriptional regulation. Component of the NC2 complex which represses RNA polymerase II transcription through binding to tbp and thereby inhibiting the assembly of the preinitiation complex.probableQ55DJ5
Negative cofactor 2 complex subunit beta probableO14348

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1JFI, chain B
Confidence level:very confident
Coverage over the Query: 12-138
View the alignment between query and template
View the model in PyMOL