Citrus Sinensis ID: 031652

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-----
MQASRARLFKEYKEVQREKSADPDIQLVCDDSNIFKWTALIKGPSETPYEGGVFQLAFAVPEQYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGMWTLFWYRLVEFISRYYPSVIMGIKS
cccHHHHHHHHHHHHHcccccccccEEEEcccccCEEEEEEEccccccccccEEEEEEEccccccccccEEEECccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHccccc
***SRARLFKEYKEVQR*KS****IQLVCDDSNIFKWTALIKGPSETPYEGGVFQLAFAVPEQYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGMWTLFWYRLVEFISRYYPSVIMG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQASRARLFKEYKEVQREKSADPDIQLVCDDSNIFKWTALIKGPSETPYEGGVFQLAFAVPEQYPLQPPQVRFLTKIFHPNVHFKTGEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGMWTLFWYRLVEFISRYYPSVIMGIKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein PEROXIN-4 Required for peroxisome biogenesis. Necessary for the developmental elimination of obsolete peroxisome matrix proteins. May be involved in the ubiquitination of PEX5, targeting it for recycling. Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.confidentQ8LGF7
Ubiquitin-conjugating enzyme E2 16 Catalyzes the covalent attachment of ubiquitin to other proteins.probableQ9P6I1
Ubiquitin-conjugating enzyme E2 2 Catalyzes the covalent attachment of ubiquitin to other proteins. Plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B to form H2BK123ub1. H2BK123ub1 gives a specific tag for epigenetic transcriptional activation and is also a prerequisite for H3K4me and H3K79me formation. Also involved in postreplication repair of UV-damaged DNA, in N-end rule-dependent protein degradation and in sporulation.probableQ75EB8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PWQ, chain A
Confidence level:very confident
Coverage over the Query: 2-147
View the alignment between query and template
View the model in PyMOL