Query         031653
Match_columns 155
No_of_seqs    184 out of 866
Neff          4.4 
Searched_HMMs 46136
Date          Fri Mar 29 03:31:31 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031653.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/031653hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0898 40S ribosomal protein  100.0 8.1E-75 1.8E-79  452.3   6.2  141   15-155    12-152 (152)
  2 PTZ00096 40S ribosomal protein 100.0 4.6E-71 9.9E-76  432.3   8.4  140   14-153     4-143 (143)
  3 TIGR01025 rpsS_arch ribosomal  100.0 8.8E-67 1.9E-71  405.1   8.8  135   21-155     1-135 (135)
  4 PRK04038 rps19p 30S ribosomal  100.0 8.5E-66 1.9E-70  399.2  10.4  133   20-155     2-134 (134)
  5 COG0185 RpsS Ribosomal protein 100.0 1.7E-42 3.6E-47  254.5   5.7   92   52-148     2-93  (93)
  6 CHL00050 rps19 ribosomal prote 100.0   9E-36 1.9E-40  218.8   6.8   81   55-139     1-84  (92)
  7 TIGR01050 rpsS_bact ribosomal  100.0 4.8E-35   1E-39  215.0   6.2   82   55-140     1-85  (92)
  8 PRK00357 rpsS 30S ribosomal pr 100.0 5.8E-35 1.3E-39  214.6   5.9   82   55-140     1-85  (92)
  9 PF00203 Ribosomal_S19:  Riboso 100.0 7.2E-35 1.6E-39  209.0   5.5   81   57-138     1-81  (81)
 10 PLN03147 ribosomal protein S19 100.0 2.5E-32 5.5E-37  200.6   6.2   78   57-141     1-81  (92)
 11 KOG0899 Mitochondrial/chloropl 100.0 2.2E-31 4.7E-36  193.8   3.6   80   54-140     9-91  (93)
 12 cd06101 citrate_synt Citrate s  72.9     3.2 6.9E-05   35.4   2.7   24   24-47     22-46  (265)
 13 PRK12350 citrate synthase 2; P  71.1     3.8 8.2E-05   36.6   2.9   24   24-47     24-48  (353)
 14 PF03131 bZIP_Maf:  bZIP Maf tr  71.1     2.9 6.2E-05   30.1   1.7   32   31-71      2-33  (92)
 15 cd06116 CaCS_like Chloroflexus  67.8     4.8  0.0001   36.2   2.8   24   24-47     28-52  (384)
 16 cd06113 citrate_synt_like_1_2   67.0     4.6  0.0001   36.6   2.6   24   24-47     37-67  (406)
 17 cd06109 BsCS-I_like Bacillus s  66.6     5.4 0.00012   35.4   2.9   24   24-47     22-46  (349)
 18 cd06108 Ec2MCS_like Escherichi  65.7     5.7 0.00012   35.5   2.8   24   24-47     22-46  (363)
 19 PRK14034 citrate synthase; Pro  64.8     5.9 0.00013   35.5   2.8   24   24-47     24-48  (372)
 20 TIGR03738 PRTRC_C PRTRC system  63.7     4.9 0.00011   28.4   1.6   28   22-49      6-34  (66)
 21 PRK14036 citrate synthase; Pro  63.6     6.6 0.00014   35.2   2.9   24   24-47     27-51  (377)
 22 cd06118 citrate_synt_like_1 Ci  63.6       6 0.00013   35.0   2.6   24   24-47     22-46  (358)
 23 PF13543 KSR1-SAM:  SAM like do  62.4     6.3 0.00014   30.9   2.2   22   28-49     89-110 (129)
 24 cd06115 AthCS_per_like Arabido  61.8     7.2 0.00016   35.5   2.8   24   24-47     48-72  (410)
 25 PRK12351 methylcitrate synthas  61.6     7.7 0.00017   34.9   2.9   26   22-47     29-55  (378)
 26 TIGR01798 cit_synth_I citrate   61.2     7.6 0.00016   35.4   2.8   24   24-47     55-79  (412)
 27 PF00285 Citrate_synt:  Citrate  60.9     5.4 0.00012   35.1   1.8   23   25-47     22-45  (356)
 28 PRK14037 citrate synthase; Pro  60.8     7.9 0.00017   34.7   2.9   23   25-47     28-51  (377)
 29 PRK14033 citrate synthase; Pro  60.6     8.1 0.00018   34.6   2.9   24   24-47     32-56  (375)
 30 cd06117 Ec2MCS_like_1 Subgroup  60.2     8.3 0.00018   34.5   2.9   25   23-47     21-46  (366)
 31 cd06107 EcCS_AthCS-per_like Es  60.1     7.9 0.00017   34.9   2.8   24   24-47     28-52  (382)
 32 cd06111 DsCS_like Cold-active   59.8     8.5 0.00019   34.3   2.9   24   24-47     22-46  (362)
 33 TIGR01800 cit_synth_II 2-methy  59.7     7.9 0.00017   34.5   2.6   23   25-47     23-46  (368)
 34 PLN02456 citrate synthase       59.3     8.4 0.00018   35.6   2.8   24   24-47     87-111 (455)
 35 cd06110 BSuCS-II_like Bacillus  59.1     8.3 0.00018   34.1   2.7   23   25-47     23-46  (356)
 36 PRK12349 citrate synthase 3; P  59.0     8.9 0.00019   34.3   2.8   24   24-47     28-52  (369)
 37 cd06112 citrate_synt_like_1_1   58.8     9.1  0.0002   34.3   2.9   24   24-47     24-48  (373)
 38 PRK09569 type I citrate syntha  58.6     7.3 0.00016   35.8   2.3   23   25-47     61-93  (437)
 39 PRK14035 citrate synthase; Pro  57.7     9.5 0.00021   34.2   2.8   24   24-47     24-48  (371)
 40 cd06114 EcCS_like Escherichia   57.3     9.8 0.00021   34.4   2.8   24   24-47     50-74  (400)
 41 PRK14032 citrate synthase; Pro  56.3     9.5  0.0002   35.1   2.6   24   24-47     67-97  (447)
 42 PRK05614 gltA type II citrate   55.6     9.6 0.00021   34.8   2.5   24   24-47     68-92  (419)
 43 PRK06224 citrate synthase; Pro  54.9      12 0.00025   31.7   2.8   23   24-46     20-43  (263)
 44 PRK00635 excinuclease ABC subu  48.5      16 0.00035   39.3   3.1   33   23-55   1646-1680(1809)
 45 cd06105 ScCit1-2_like Saccharo  45.0      17 0.00036   33.5   2.3   23   25-47     59-91  (427)
 46 cd06103 ScCS-like Saccharomyce  44.8      17 0.00036   33.4   2.3   22   26-47     60-91  (426)
 47 cd06102 citrate_synt_like_2 Ci  41.3      24 0.00052   30.6   2.7   26   23-48     31-57  (282)
 48 cd06106 ScCit3_like Saccharomy  40.1      20 0.00043   33.0   2.0   23   25-47     59-91  (428)
 49 PF14454 Prok_Ub:  Prokaryotic   36.8      24 0.00051   24.6   1.6   28   22-49      7-35  (65)
 50 PF05361 PP1_inhibitor:  PKC-ac  35.5      13 0.00027   29.9   0.1   40   29-76     73-120 (144)
 51 PF12936 Kri1_C:  KRI1-like fam  33.9      45 0.00098   24.6   2.8   30   22-51     26-62  (93)
 52 TIGR00630 uvra excinuclease AB  33.3      36 0.00078   34.2   2.8   27   23-49    775-801 (924)
 53 PF01783 Ribosomal_L32p:  Ribos  32.1      28 0.00061   23.0   1.3   49   49-115     8-56  (56)
 54 smart00540 LEM in nuclear memb  28.6 1.1E+02  0.0023   19.8   3.5   35   33-74      1-41  (44)
 55 COG0178 UvrA Excinuclease ATPa  28.3      50  0.0011   33.5   2.8   35   21-55    767-803 (935)
 56 PF06528 Phage_P2_GpE:  Phage P  27.5   1E+02  0.0023   19.5   3.3   20   29-48      9-28  (39)
 57 PRK01110 rpmF 50S ribosomal pr  26.6      40 0.00087   22.9   1.3   21   94-115    36-56  (60)
 58 TIGR01793 cit_synth_euk citrat  26.5      52  0.0011   30.3   2.4   23   25-47     62-94  (427)
 59 PF08921 DUF1904:  Domain of un  25.6      37 0.00081   25.5   1.1   27   25-51      4-33  (108)
 60 cd00166 SAM Sterile alpha moti  25.3      54  0.0012   20.3   1.7   19   28-46     26-44  (63)
 61 PF09597 IGR:  IGR protein moti  25.0      46   0.001   22.6   1.4   25   32-56     23-48  (57)
 62 TIGR01689 EcbF-BcbF capsule bi  24.9      57  0.0012   25.0   2.0   22   28-49    100-121 (126)
 63 COG0372 GltA Citrate synthase   24.9      58  0.0013   29.7   2.4   22   25-46     40-62  (390)
 64 PF10109 FluMu_gp41:  Mu-like p  24.3      86  0.0019   20.9   2.7   22   28-49     55-76  (82)
 65 PF07647 SAM_2:  SAM domain (St  22.7      39 0.00085   21.7   0.7   34   22-55     22-58  (66)
 66 PRK00349 uvrA excinuclease ABC  21.1      92   0.002   31.5   3.1   28   21-48    775-802 (943)
 67 TIGR00630 uvra excinuclease AB  20.3      78  0.0017   31.9   2.5   27   23-49    420-446 (924)

No 1  
>KOG0898 consensus 40S ribosomal protein S15 [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=8.1e-75  Score=452.27  Aligned_cols=141  Identities=82%  Similarity=1.299  Sum_probs=139.6

Q ss_pred             cCCccccceeeeeecCChhHHhcCCHHHHHHHHHHHHHhhhhcCCCCCcchHHHHHHHhhhcCCCCCCCCceEeccCCce
Q 031653           15 GLPKKRTFKKFSFRGVDLDALLDMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMI   94 (155)
Q Consensus        15 ~~~KKrtf~kFtYRG~~ld~L~~ms~eel~~L~~ar~RR~~~Rgl~k~~~~Llkklrkak~~~~~~~kp~~ikt~~R~~~   94 (155)
                      .++|||||++|||||+|||||+|||.|||++|+|||+||+++|||+++|+.|+++||+|++++++++||++|+||+||||
T Consensus        12 ~~kKKRTFrkftyrGVdld~Lldms~~~~~~l~~ar~rrR~~RGL~~k~~~liKklrkAkk~A~~~ekpe~VkTHlR~mI   91 (152)
T KOG0898|consen   12 VLKKKRTFRKFTYRGVDLDQLLDMSTEQLVKLFPARQRRRLNRGLTRKPHSLIKKLRKAKKEAPPMEKPEVVKTHLRNMI   91 (152)
T ss_pred             HHhhhhhhhhccccCCCHHHHhcCCHHHHHHHHHHHHHHHHHcccccchHHHHHHHHHHHhhcCcccCcHHHHHHhhcce
Confidence            58899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecccccccEEEEecCCcccccccCCCcceeeeeeeeeeeecccCCCCCCCCCCCCCcccCC
Q 031653           95 IVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK  155 (155)
Q Consensus        95 IlP~mvG~~v~VyNGK~f~~v~I~~eMIGhkLGEFa~Trk~~~H~~pGigAT~sS~fvplK  155 (155)
                      |+|||||+.|||||||+|++|||+|||||||||||||||||++||+|||||||||+|+|||
T Consensus        92 I~PEMvGs~VGVyNGK~FnqvEiKPEMIGhYL~eFsiTykpvkHgrpgigat~SsrfipLk  152 (152)
T KOG0898|consen   92 IVPEMVGSMVGVYNGKTFNQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSSRFIPLK  152 (152)
T ss_pred             eeHhhhcceEEEecCcccceeeccHHHHhhhhhhccccccccccCCCCCCcccccccccCC
Confidence            9999999999999999999999999999999999999999999999999999999999997


No 2  
>PTZ00096 40S ribosomal protein S15; Provisional
Probab=100.00  E-value=4.6e-71  Score=432.29  Aligned_cols=140  Identities=71%  Similarity=1.212  Sum_probs=137.3

Q ss_pred             hcCCccccceeeeeecCChhHHhcCCHHHHHHHHHHHHHhhhhcCCCCCcchHHHHHHHhhhcCCCCCCCCceEeccCCc
Q 031653           14 AGLPKKRTFKKFSFRGVDLDALLDMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNM   93 (155)
Q Consensus        14 ~~~~KKrtf~kFtYRG~~ld~L~~ms~eel~~L~~ar~RR~~~Rgl~k~~~~Llkklrkak~~~~~~~kp~~ikt~~R~~   93 (155)
                      ++++|+|+|++|+|||+|||||++||+|||++|+||||||+++|||.+++.+||++|++++++++++++|++|+||+|+|
T Consensus         4 ~~~~k~r~~k~f~yRG~~l~~L~~m~~~e~~~L~~aR~RR~~~RGl~~~~~~LlkKirk~~~~~~~~~k~~~ikT~~R~~   83 (143)
T PTZ00096          4 EQLKKKRTFKKFTYRGVELEKLLALPEEELVELFRARQRRRINRGIKRKHPTLLKKLRKAKKATKPGEKPKAVKTHLRDM   83 (143)
T ss_pred             cccccccccceeeeecCCHHHHHcCCHHHHHHHcCcccccccccCCCHHHHHHHHHHHHHhhhcccccCCcceeEecccC
Confidence            47789999999999999999999999999999999999999999999999999999999999888899999999999999


Q ss_pred             eecccccccEEEEecCCcccccccCCCcceeeeeeeeeeeecccCCCCCCCCCCCCCccc
Q 031653           94 IIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIP  153 (155)
Q Consensus        94 ~IlP~mvG~~v~VyNGK~f~~v~I~~eMIGhkLGEFa~Trk~~~H~~pGigAT~sS~fvp  153 (155)
                      +|||+|||++|+|||||+|++|+|+||||||||||||+||+++.||+|||||||||+|||
T Consensus        84 ~IlP~mVG~ti~VyNGK~fv~V~I~~eMIGhkLGEFa~Trk~~~Hg~pGigATrSS~fvp  143 (143)
T PTZ00096         84 IIVPEMVGSVVGVYNGKQFNNVEIKPEMIGHYLGEFSITYKPVRHGKPGVGATHSSRFIP  143 (143)
T ss_pred             eeCccccCcEEEEEcCCeeEeeEeccCeeceeeccccCCcccccCCCCCcCcccccccCC
Confidence            999999999999999999999999999999999999999999999999999999999998


No 3  
>TIGR01025 rpsS_arch ribosomal protein S19(archaeal)/S15(eukaryotic). This model represents eukaryotic ribosomal protein S15 and its archaeal equivalent. It excludes bacterial and organellar ribosomal protein S19. The nomenclature for the archaeal members is unresolved and given variously as S19 (after the more distant bacterial homologs) or S15.
Probab=100.00  E-value=8.8e-67  Score=405.12  Aligned_cols=135  Identities=70%  Similarity=1.122  Sum_probs=130.7

Q ss_pred             cceeeeeecCChhHHhcCCHHHHHHHHHHHHHhhhhcCCCCCcchHHHHHHHhhhcCCCCCCCCceEeccCCceeccccc
Q 031653           21 TFKKFSFRGVDLDALLDMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMI  100 (155)
Q Consensus        21 tf~kFtYRG~~ld~L~~ms~eel~~L~~ar~RR~~~Rgl~k~~~~Llkklrkak~~~~~~~kp~~ikt~~R~~~IlP~mv  100 (155)
                      +|++|+|||++||+|++||++||++|+||||||++.||+...+.+||++++++++....+++|++|+||+|+|+|+|+||
T Consensus         1 ~~~~f~yrG~~l~~L~~m~~~e~~~l~~ar~RRs~~RG~~~~~~~Llkki~k~~~~~~~g~k~~~IKT~sR~s~IlP~~V   80 (135)
T TIGR01025         1 TFKEFRYRGYTLEELQDMSLEELAKLLPARQRRRLKRGLTPKQKKLLKKLRKAKKEAPKGEKPEVIRTHCRDMIILPEMV   80 (135)
T ss_pred             CCceEeecccCHHHHHcCCHHHHHHHcCcccCcccccCCchhhHHHHHHHHHHHhccccccCCcceEEeccCCeeChhhc
Confidence            68999999999999999999999999999999999999999999999999998876666778899999999999999999


Q ss_pred             ccEEEEecCCcccccccCCCcceeeeeeeeeeeecccCCCCCCCCCCCCCcccCC
Q 031653          101 GSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK  155 (155)
Q Consensus       101 G~~v~VyNGK~f~~v~I~~eMIGhkLGEFa~Trk~~~H~~pGigAT~sS~fvplK  155 (155)
                      |++|+|||||+|++|+|+||||||||||||+||+++.||+||||||+||+|||||
T Consensus        81 G~ti~VyNGk~fv~v~I~~eMVGhklGEFa~Trk~~~Hg~pGigAt~ss~fvplK  135 (135)
T TIGR01025        81 GSTVGVYNGKEFVQVEIKPEMIGHYLGEFSITRKPVKHGRPGIGATRSSMFVPLK  135 (135)
T ss_pred             CcEEEEEcCCeeEEEEecCCeeceeecccccCcccCcCCCCCcCccccccceeCc
Confidence            9999999999999999999999999999999999999999999999999999997


No 4  
>PRK04038 rps19p 30S ribosomal protein S19P; Provisional
Probab=100.00  E-value=8.5e-66  Score=399.18  Aligned_cols=133  Identities=54%  Similarity=0.955  Sum_probs=127.4

Q ss_pred             ccceeeeeecCChhHHhcCCHHHHHHHHHHHHHhhhhcCCCCCcchHHHHHHHhhhcCCCCCCCCceEeccCCceecccc
Q 031653           20 RTFKKFSFRGVDLDALLDMSNDELVKLFSARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEM   99 (155)
Q Consensus        20 rtf~kFtYRG~~ld~L~~ms~eel~~L~~ar~RR~~~Rgl~k~~~~Llkklrkak~~~~~~~kp~~ikt~~R~~~IlP~m   99 (155)
                      ++|++|+|||+|||||++||+|||++|+||||||++.||+...+.+||++++++++.   +++|++|+||+|+|+|+|+|
T Consensus         2 ~~~~~f~yrG~~l~~L~~m~~~~~~~l~~ar~RRsl~KGp~~~~~~LlkKi~k~~~~---~~k~~~ikT~sR~s~IlP~~   78 (134)
T PRK04038          2 KRWKEFTYRGYTLEELQEMSLEEFAELLPARQRRSLKRGLTPEQRKLLEKIRKARRE---KKKGRVIRTHVRDMIILPEM   78 (134)
T ss_pred             CccceeeecccCHHHHHcCCHHHHHHHcchhhhhhhccCCCcchHHHHHHHHHHHhc---ccCCcceeEeccCCeeChhh
Confidence            689999999999999999999999999999999999999998899999999998753   34567899999999999999


Q ss_pred             cccEEEEecCCcccccccCCCcceeeeeeeeeeeecccCCCCCCCCCCCCCcccCC
Q 031653          100 IGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK  155 (155)
Q Consensus       100 vG~~v~VyNGK~f~~v~I~~eMIGhkLGEFa~Trk~~~H~~pGigAT~sS~fvplK  155 (155)
                      ||++|+|||||+|++|+|+||||||||||||+||+++.||+|||||||||+|||||
T Consensus        79 VG~ti~VyNGk~fv~v~I~~eMVGhklGEFa~Trk~~~Hg~pGigAT~sS~fvplK  134 (134)
T PRK04038         79 VGLTIAVYNGKEFVEVEIVPEMIGHYLGEFALTRKRVQHGSPGIGATRSSKFVPLK  134 (134)
T ss_pred             cCeEEEEecCceeEeEEeccCccceeeccccCCcccCcCCCCCcCccccccceeCc
Confidence            99999999999999999999999999999999999999999999999999999997


No 5  
>COG0185 RpsS Ribosomal protein S19 [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=1.7e-42  Score=254.49  Aligned_cols=92  Identities=48%  Similarity=0.703  Sum_probs=81.4

Q ss_pred             HhhhhcCCCCCcchHHHHHHHhhhcCCCCCCCCceEeccCCceecccccccEEEEecCCcccccccCCCcceeeeeeeee
Q 031653           52 RRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSI  131 (155)
Q Consensus        52 RR~~~Rgl~k~~~~Llkklrkak~~~~~~~kp~~ikt~~R~~~IlP~mvG~~v~VyNGK~f~~v~I~~eMIGhkLGEFa~  131 (155)
                      ||++.||.. .+.+||+++++++..   +++ ++||||||+|+|||+|||++|+|||||+|++|+|+|||||||||||||
T Consensus         2 ~RSlkkGp~-~~~~Ll~Kv~~~~~~---~~k-~~IkT~sR~stIlPemVG~ti~VhNGk~~vpV~I~~eMVGHkLGEFap   76 (93)
T COG0185           2 RRSLKKGPF-VDKHLLKKVRKAKES---GKK-KPIKTWSRRSTILPEMVGLTIAVHNGKKFVPVEITEEMVGHKLGEFAP   76 (93)
T ss_pred             CcccccCcc-ccHHHHHHHHHHHhc---cCC-CcceeeecccEechhhcCcEEEEEcCceEEEEEechhhcceecccccc
Confidence            455555554 445999999998863   233 689999999999999999999999999999999999999999999999


Q ss_pred             eeecccCCCCCCCCCCC
Q 031653          132 SYKPVKHGRPGIGATHS  148 (155)
Q Consensus       132 Trk~~~H~~pGigAT~s  148 (155)
                      ||+++.|+.||+|||+|
T Consensus        77 TR~~~~H~~~~~~atr~   93 (93)
T COG0185          77 TRTFVGHGADGIKATRS   93 (93)
T ss_pred             eecccccCCCCcCcccC
Confidence            99999999999999986


No 6  
>CHL00050 rps19 ribosomal protein S19
Probab=100.00  E-value=9e-36  Score=218.75  Aligned_cols=81  Identities=37%  Similarity=0.552  Sum_probs=74.3

Q ss_pred             hhcCCCCCcc---hHHHHHHHhhhcCCCCCCCCceEeccCCceecccccccEEEEecCCcccccccCCCcceeeeeeeee
Q 031653           55 FQRGLKRKPM---ALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSI  131 (155)
Q Consensus        55 ~~Rgl~k~~~---~Llkklrkak~~~~~~~kp~~ikt~~R~~~IlP~mvG~~v~VyNGK~f~~v~I~~eMIGhkLGEFa~  131 (155)
                      |.||+|++|+   +||++++++..    .+++++|+||+|+|+|||+|||++|+|||||+|++|+|+||||||||||||+
T Consensus         1 M~RS~wKgpfv~~~Ll~ki~~~~~----~~~~~~ikT~sR~s~IlP~~vg~t~~VyNGk~fv~v~I~~eMVGhklGEFa~   76 (92)
T CHL00050          1 MTRSLKKNPFVANHLLKKIEKLNT----KEEKEIIVTWSRASTIIPTMIGHTIAVHNGKEHIPIYITDQMVGHKLGEFAP   76 (92)
T ss_pred             CCCccccCcccCHHHHHHHHHhhh----ccCCccceEEccccEeChhhcCcEEEEEcCceEEEEEEccccccceeeeEee
Confidence            7899999997   89999987653    2345689999999999999999999999999999999999999999999999


Q ss_pred             eeecccCC
Q 031653          132 SYKPVKHG  139 (155)
Q Consensus       132 Trk~~~H~  139 (155)
                      ||+++.|+
T Consensus        77 TRk~~~h~   84 (92)
T CHL00050         77 TRNFRGHA   84 (92)
T ss_pred             eecccccc
Confidence            99999995


No 7  
>TIGR01050 rpsS_bact ribosomal protein S19, bacterial/organelle. the Archaea may be designated S15 or S19.
Probab=100.00  E-value=4.8e-35  Score=214.96  Aligned_cols=82  Identities=39%  Similarity=0.608  Sum_probs=75.0

Q ss_pred             hhcCCCCCcc---hHHHHHHHhhhcCCCCCCCCceEeccCCceecccccccEEEEecCCcccccccCCCcceeeeeeeee
Q 031653           55 FQRGLKRKPM---ALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSI  131 (155)
Q Consensus        55 ~~Rgl~k~~~---~Llkklrkak~~~~~~~kp~~ikt~~R~~~IlP~mvG~~v~VyNGK~f~~v~I~~eMIGhkLGEFa~  131 (155)
                      |+||+|++|+   +|++++++++.    .+++++|+||+|+|+|||+|||++|+||||++|++|+|++||||||||||++
T Consensus         1 MsRS~wKgpfv~~~Ll~ki~k~~~----~~~~~~ikT~sR~s~IlP~~vg~~i~VynGk~fv~v~I~~~MvGhklGEFa~   76 (92)
T TIGR01050         1 MSRSLKKGPFVDHHLLKKVEKLNE----SGKKKVIKTWSRRSTIIPEMIGHTIAVHNGKKFIPVYITEDMVGHKLGEFAP   76 (92)
T ss_pred             CCcccccCccccHHHHHHHHHhhc----ccCCCceEEEecccEEChHHCCcEEEEEcCceEEEEEeCcCeecceeeeeec
Confidence            6899999996   89999988752    2345689999999999999999999999999999999999999999999999


Q ss_pred             eeecccCCC
Q 031653          132 SYKPVKHGR  140 (155)
Q Consensus       132 Trk~~~H~~  140 (155)
                      ||+++.|++
T Consensus        77 TRk~~~h~~   85 (92)
T TIGR01050        77 TRTFKGHAK   85 (92)
T ss_pred             eeecccccc
Confidence            999999975


No 8  
>PRK00357 rpsS 30S ribosomal protein S19; Reviewed
Probab=100.00  E-value=5.8e-35  Score=214.57  Aligned_cols=82  Identities=33%  Similarity=0.528  Sum_probs=74.4

Q ss_pred             hhcCCCCCcc---hHHHHHHHhhhcCCCCCCCCceEeccCCceecccccccEEEEecCCcccccccCCCcceeeeeeeee
Q 031653           55 FQRGLKRKPM---ALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSI  131 (155)
Q Consensus        55 ~~Rgl~k~~~---~Llkklrkak~~~~~~~kp~~ikt~~R~~~IlP~mvG~~v~VyNGK~f~~v~I~~eMIGhkLGEFa~  131 (155)
                      |+||+|++|+   +||+++++++..    .++++|+||+|+|+|+|+|||++|+||||++|++|+|+|||||||||||++
T Consensus         1 M~RS~~Kgp~v~~~Ll~ki~k~~~~----~~~~~ikT~sR~s~IlP~~vg~~i~VyNGk~fv~v~I~~emiGhklGEFa~   76 (92)
T PRK00357          1 MARSLKKGPFVDGHLLKKVEKANES----GDKKVIKTWSRRSTILPEFVGLTIAVHNGRKHVPVYVTENMVGHKLGEFAP   76 (92)
T ss_pred             CCcccccCccccHHHHHHHHHHhhc----cCCCceEEeeccCCcCHHHCCceEEEEcCCeeEeEEeccCccceeeeeecc
Confidence            6899999996   899999987531    235679999999999999999999999999999999999999999999999


Q ss_pred             eeecccCCC
Q 031653          132 SYKPVKHGR  140 (155)
Q Consensus       132 Trk~~~H~~  140 (155)
                      ||++++|+.
T Consensus        77 Tr~~~~H~~   85 (92)
T PRK00357         77 TRTFRGHAA   85 (92)
T ss_pred             eeccccccc
Confidence            999999973


No 9  
>PF00203 Ribosomal_S19:  Ribosomal protein S19;  InterPro: IPR002222 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. The small subunit ribosomal proteins can be categorised as: primary binding proteins, which bind directly and independently to 16S rRNA; secondary binding proteins, which display no specific affinity for 16S rRNA, but its assembly is contingent upon the presence of one or more primary binding proteins; and tertiary binding proteins, which require the presence of one or more secondary binding proteins and sometimes other tertiary binding proteins. The small ribosomal subunit protein S19 contains 88-144 amino acid residues. In Escherichia coli, S19 is known to form a complex with S13 that binds strongly to 16S ribosomal RNA. Experimental evidence [] has revealed that S19 is moderately exposed on the ribosomal surface, and is designated a secondary rRNA binding protein. S19 belongs to a family of ribosomal proteins [, ] that includes: eubacterial S19; algal and plant chloroplast S19; cyanelle S19; archaebacterial S19; plant mitochondrial S19; and eukaryotic S15 ('rig' protein).; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005840 ribosome; PDB: 2XZM_S 2XZN_S 2ZKQ_s 3U5C_P 3O30_I 3U5G_P 3O2Z_I 3IZB_R 1S1H_S 1XMO_S ....
Probab=100.00  E-value=7.2e-35  Score=209.03  Aligned_cols=81  Identities=51%  Similarity=0.838  Sum_probs=73.8

Q ss_pred             cCCCCCcchHHHHHHHhhhcCCCCCCCCceEeccCCceecccccccEEEEecCCcccccccCCCcceeeeeeeeeeeecc
Q 031653           57 RGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPV  136 (155)
Q Consensus        57 Rgl~k~~~~Llkklrkak~~~~~~~kp~~ikt~~R~~~IlP~mvG~~v~VyNGK~f~~v~I~~eMIGhkLGEFa~Trk~~  136 (155)
                      ||+|++|+.+...++++++..+..++ ++|+||+|+|+|+|+|||++|+|||||+|++|+|+|||||||||||++||+++
T Consensus         1 Rs~~K~~~~~~~~l~k~~~~~~~~~k-~~ikt~~R~s~IlP~~vg~~i~VyNGk~f~~i~I~~~miG~klGEF~~Trk~~   79 (81)
T PF00203_consen    1 RSLWKGPFVLKKLLKKIKKLNPSKKK-KVIKTHSRSSTILPEMVGKTIGVYNGKKFVPIKITPEMIGHKLGEFAPTRKPV   79 (81)
T ss_dssp             CCSSSSTHHHHHHHHHHHHHHCTTST-SEEEESSTTSBBSGTGTTSEEEEESSSSEEEEECSSTGTSSBCGCGSSSSSTS
T ss_pred             CCCCcccchhHHHHHHHHHHhhcCCC-cceEEEeCCCCcccceeceEEEEecCceEEEEEecccccceEeeceeeecccC
Confidence            89999999887777777655544554 78999999999999999999999999999999999999999999999999999


Q ss_pred             cC
Q 031653          137 KH  138 (155)
Q Consensus       137 ~H  138 (155)
                      +|
T Consensus        80 ~H   81 (81)
T PF00203_consen   80 KH   81 (81)
T ss_dssp             CT
T ss_pred             CC
Confidence            98


No 10 
>PLN03147 ribosomal protein S19; Provisional
Probab=99.97  E-value=2.5e-32  Score=200.61  Aligned_cols=78  Identities=21%  Similarity=0.347  Sum_probs=69.0

Q ss_pred             cCCCCCcc---hHHHHHHHhhhcCCCCCCCCceEeccCCceecccccccEEEEecCCcccccccCCCcceeeeeeeeeee
Q 031653           57 RGLKRKPM---ALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFSISY  133 (155)
Q Consensus        57 Rgl~k~~~---~Llkklrkak~~~~~~~kp~~ikt~~R~~~IlP~mvG~~v~VyNGK~f~~v~I~~eMIGhkLGEFa~Tr  133 (155)
                      ||+|++|+   +|+ ++.+++..      ..+|+||||+|+|||+|||++|+|||||+|++|+|+|||||||||||++||
T Consensus         1 RS~wKGPfv~~~L~-k~~~~~~~------~~~iktwSR~S~IlP~~vg~ti~VyNGk~fv~v~It~~MVGhKlGEFa~Tr   73 (92)
T PLN03147          1 QAIWKGAFVDAFLA-RIKKKRDL------LLGKKIWSHRSSILPDFVDCSVLIYNGKTHIRCKITEGKVGHKFGEFAFTR   73 (92)
T ss_pred             CCCccCccccHHHH-HHHHHHhc------CCceeEEcccceECHHHcCCEEEEeCCCceEEEEecCCccceeeeccccEe
Confidence            89999997   664 57665431      147999999999999999999999999999999999999999999999999


Q ss_pred             ecccCCCC
Q 031653          134 KPVKHGRP  141 (155)
Q Consensus       134 k~~~H~~p  141 (155)
                      +++.|...
T Consensus        74 k~~~hk~~   81 (92)
T PLN03147         74 KRRPHRAI   81 (92)
T ss_pred             cccCCCCc
Confidence            99999754


No 11 
>KOG0899 consensus Mitochondrial/chloroplast ribosomal protein S19 [Translation, ribosomal structure and biogenesis]
Probab=99.97  E-value=2.2e-31  Score=193.76  Aligned_cols=80  Identities=33%  Similarity=0.575  Sum_probs=70.7

Q ss_pred             hhhcCCCCCcc---hHHHHHHHhhhcCCCCCCCCceEeccCCceecccccccEEEEecCCcccccccCCCcceeeeeeee
Q 031653           54 RFQRGLKRKPM---ALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQVEIKPEMIGHYLAEFS  130 (155)
Q Consensus        54 ~~~Rgl~k~~~---~Llkklrkak~~~~~~~kp~~ikt~~R~~~IlP~mvG~~v~VyNGK~f~~v~I~~eMIGhkLGEFa  130 (155)
                      +|.||+|++|+   .|+++..+.+.       ..+|+||+|+++|||+|||++|.|||||+|++|+|+++|||||||||+
T Consensus         9 Sm~RSvwK~P~V~~~~~rk~~~~~~-------~~pikt~sRasTIlP~~Vg~~~~IhNGk~~v~vkIte~mVGHKlGEFa   81 (93)
T KOG0899|consen    9 SMTRSVWKGPFVVKFLLRKIEKLKG-------KAPIKTWSRASTILPTMVGHTFAIHNGKEHVPVKITEDMVGHKLGEFA   81 (93)
T ss_pred             HHHHHhhcCcchhHHHHHHHHHhcC-------CCceeehhhhcchhhhhhCceEEEecCcceeeEEeecchhcccccccc
Confidence            39999999997   55665555432       235999999999999999999999999999999999999999999999


Q ss_pred             eeeecccCCC
Q 031653          131 ISYKPVKHGR  140 (155)
Q Consensus       131 ~Trk~~~H~~  140 (155)
                      +|||...|.+
T Consensus        82 pTrk~~~~ak   91 (93)
T KOG0899|consen   82 PTRKFFGHAK   91 (93)
T ss_pred             chhhhhcccc
Confidence            9999999975


No 12 
>cd06101 citrate_synt Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle). Peroxisomal CS is involved in the glyoxylate cycle. This group also includes CS proteins which functions as a 2-methylcitrate synthase (2MCS). 2MCS catalyzes the condensation of propionyl-CoA (PrCoA) and OAA to form 2-methylcitrate and CoA during propionate metabolism. This group contains proteins which functions exclusively as either a CS or a 2MCS, as well as those with relaxed specificity which have dual functions as both a CS and a 2MCS. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the 
Probab=72.85  E-value=3.2  Score=35.36  Aligned_cols=24  Identities=25%  Similarity=0.495  Sum_probs=20.7

Q ss_pred             eeeeecCChhHHh-cCCHHHHHHHH
Q 031653           24 KFSFRGVDLDALL-DMSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~-~ms~eel~~L~   47 (155)
                      +..|||+|++||. ++|++|.+-|+
T Consensus        22 ~l~yRGy~i~dL~~~~~f~ev~~LL   46 (265)
T cd06101          22 GLRYRGYPIEELAENSSFEEVAYLL   46 (265)
T ss_pred             EEEECCeeHHHHHhcCCHHHHHHHH
Confidence            4789999999998 78899987764


No 13 
>PRK12350 citrate synthase 2; Provisional
Probab=71.13  E-value=3.8  Score=36.64  Aligned_cols=24  Identities=25%  Similarity=0.610  Sum_probs=20.3

Q ss_pred             eeeeecCChhHHhcC-CHHHHHHHH
Q 031653           24 KFSFRGVDLDALLDM-SNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~m-s~eel~~L~   47 (155)
                      ..+|||++++||-+- |+||.+-||
T Consensus        24 ~L~YRGy~i~dLa~~~sFeEva~LL   48 (353)
T PRK12350         24 ALRYRGVDIEDLVGRVTFEDVWALL   48 (353)
T ss_pred             EEEECCccHHHHhccCCHHHHHHHH
Confidence            489999999999965 789987764


No 14 
>PF03131 bZIP_Maf:  bZIP Maf transcription factor;  InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell. MafG and MafH are small Mafs which lack a putative transactivation domain. They behave as transcriptional repressors when they dimerize among themselves. However they also serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins and recruiting them to specific DNA-binding sites. Maf transcription factors contain a conserved basic region leucine zipper (bZIP) domain, which mediates their dimerization and DNA binding property. Neural retina-specific leucine zipper proteins also belong to this family. Together with the basic region, the Maf extended homology region (EHR), conserved only within the Maf family, defines the DNA binding specific to Mafs. This structure enables Mafs to make a broader area of contact with DNA and to recognise longer DNA sequences. In particular, the two residues at the beginning of helix H2 are positioned to recognise the flanking region []. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NF2-E2 transcription factor.  In mouse, Maf1 may play an early role in axial patterning. Defects in these proteins are a cause of autosomal dominant retinitis pigmentosa. ; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2KZ5_A 3A5T_A 1K1V_A 1SKN_P 2WT7_B 2WTY_B.
Probab=71.09  E-value=2.9  Score=30.09  Aligned_cols=32  Identities=34%  Similarity=0.527  Sum_probs=20.2

Q ss_pred             ChhHHhcCCHHHHHHHHHHHHHhhhhcCCCCCcchHHHHHH
Q 031653           31 DLDALLDMSNDELVKLFSARARRRFQRGLKRKPMALIKKLR   71 (155)
Q Consensus        31 ~ld~L~~ms~eel~~L~~ar~RR~~~Rgl~k~~~~Llkklr   71 (155)
                      +-|+|..||.+||-.++         +|++..+...|+.+|
T Consensus         2 s~eeL~~m~v~efn~~L---------~~lt~~q~~~lK~~R   33 (92)
T PF03131_consen    2 SDEELVSMSVREFNRLL---------RGLTEEQIAELKQRR   33 (92)
T ss_dssp             -HHHHHHS-HHHHHHHC---------TTS-HHHHHHHHHHH
T ss_pred             CHHHHhhCCHHHHHHHH---------HcCCHHHHHHHHHHH
Confidence            67899999999986665         556655555555544


No 15 
>cd06116 CaCS_like Chloroflexus aurantiacus (Ca) citrate synthase (CS)_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). This group is similar to gram-negative Escherichia coli (Ec) CS (type II, gltA) and Arabidopsis thaliana (Ath) peroxisomal (Per) CS. However EcCS and AthPerCS are not found in this group. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA.   There are two types of CSs: type I CS and type II CSs.  Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homodimers w
Probab=67.77  E-value=4.8  Score=36.24  Aligned_cols=24  Identities=25%  Similarity=0.416  Sum_probs=20.1

Q ss_pred             eeeeecCChhHHhc-CCHHHHHHHH
Q 031653           24 KFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      +..|||++++||.+ -++||.+-||
T Consensus        28 ~L~YRGy~I~dL~~~~~feEv~yLL   52 (384)
T cd06116          28 ILRYRGYPIEQLAEQSSYLEVAYLL   52 (384)
T ss_pred             eEEECCccHHHHhccCCHHHHHHHH
Confidence            58999999999996 6888876664


No 16 
>cd06113 citrate_synt_like_1_2 Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle). Peroxisomal CS is involved in the glyoxylate cycle. This group also includes CS proteins which functions as a 2-methylcitrate synthase (2MCS). 2MCS catalyzes the condensation of propionyl-CoA (PrCoA) and OAA to form 2-methylcitrate and CoA during propionate metabolism. This group contains proteins which functions exclusively as either a CS or a 2MCS, as well as those with relaxed specificity which have dual functions as both a CS and a 2MCS. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) a carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) h
Probab=67.04  E-value=4.6  Score=36.60  Aligned_cols=24  Identities=29%  Similarity=0.533  Sum_probs=19.7

Q ss_pred             eeeeecCChhHHhcC-------CHHHHHHHH
Q 031653           24 KFSFRGVDLDALLDM-------SNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~m-------s~eel~~L~   47 (155)
                      +..|||++++||.+-       ++||.+-||
T Consensus        37 ~L~yRGy~I~dLa~~~p~~~~~sFEev~yLL   67 (406)
T cd06113          37 KLYYRGYDVEDLVNGAQKENRFGFEETAYLL   67 (406)
T ss_pred             eeeECCCcHHHHHhhcccccCCCHHHHHHHH
Confidence            589999999999975       788866554


No 17 
>cd06109 BsCS-I_like Bacillus subtilis (Bs) citrate synthase CS-I_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). 2MCS catalyzes the condensation of propionyl-coenzyme A (PrCoA) and OAA to form 2-methylcitrate and coenzyme A (CoA) during propionate metabolism. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. This group contains proteins similar to BsCS-I, one of two CS isozymes in the gram-positive B. subtilis. The majority of CS activity in B. subtilis is provided by the other isozyme, BsCS-II (not included in this group). BsCS-
Probab=66.61  E-value=5.4  Score=35.43  Aligned_cols=24  Identities=21%  Similarity=0.459  Sum_probs=20.3

Q ss_pred             eeeeecCChhHHhc-CCHHHHHHHH
Q 031653           24 KFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      ...|||++++||.+ -++||.+-|+
T Consensus        22 ~L~YRGy~i~dL~~~~~feev~~LL   46 (349)
T cd06109          22 RLIIRGYSVEDLAGSASFEDVAALL   46 (349)
T ss_pred             eEEECCccHHHHHhhCCHHHHHHHH
Confidence            48899999999996 6789977665


No 18 
>cd06108 Ec2MCS_like Escherichia coli (Ec) 2-methylcitrate synthase (2MCS)_like. 2MCS catalyzes the condensation of propionyl-coenzyme A (PrCoA) and oxalacetate (OAA) to form 2-methylcitrate and coenzyme A (CoA) during propionate metabolism. Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and OAA to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). This group contains proteins similar to the E. coli 2MCS, EcPrpC.  EcPrpC is one of two CS isozymes in the gram-negative E. coli. EcPrpC is a dimeric (type I ) CS; it is induced during growth on propionate and prefers PrCoA as a substrate though it has partial CS activity with AcCoA. This group also includes Salmonella typhimurium PrpC and Ralstonia eutropha (Re) 2-MCS1 which are also induced during growth on propionate and prefer PrCoA as substrate, but can also use AcCoA. Re 2-MCS1 can use butyryl-CoA and valeryl-CoA at a lower rate. A second Ralstonia eutropha 2MC
Probab=65.66  E-value=5.7  Score=35.53  Aligned_cols=24  Identities=25%  Similarity=0.596  Sum_probs=20.4

Q ss_pred             eeeeecCChhHHhc-CCHHHHHHHH
Q 031653           24 KFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      ...|||++++||.+ -++||++-|+
T Consensus        22 ~L~yRGy~i~dLa~~~sfeeva~LL   46 (363)
T cd06108          22 GLTYRGYDIEDLAENATFEEVAYLL   46 (363)
T ss_pred             EEEECCccHHHHHhcCCHHHHHHHH
Confidence            58999999999997 6799987665


No 19 
>PRK14034 citrate synthase; Provisional
Probab=64.84  E-value=5.9  Score=35.53  Aligned_cols=24  Identities=29%  Similarity=0.569  Sum_probs=20.4

Q ss_pred             eeeeecCChhHHhc-CCHHHHHHHH
Q 031653           24 KFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      ...|||++++||.+ -++||.+-|+
T Consensus        24 ~L~YRGy~i~dLa~~~~fEeva~LL   48 (372)
T PRK14034         24 TLTYVGYNIDDLAENASFEEVVYLL   48 (372)
T ss_pred             eEEECCccHHHHhccCCHHHHHHHH
Confidence            59999999999996 6788977664


No 20 
>TIGR03738 PRTRC_C PRTRC system protein C. A novel genetic system characterized by six major proteins, included a ParB homolog and a ThiF homolog, is designated PRTRC, or ParB-Related,ThiF-Related Cassette. It is often found on plasmids. This protein family is designated PRTRC system protein C.
Probab=63.68  E-value=4.9  Score=28.36  Aligned_cols=28  Identities=29%  Similarity=0.504  Sum_probs=24.1

Q ss_pred             ceeeeeecCChhHH-hcCCHHHHHHHHHH
Q 031653           22 FKKFSFRGVDLDAL-LDMSNDELVKLFSA   49 (155)
Q Consensus        22 f~kFtYRG~~ld~L-~~ms~eel~~L~~a   49 (155)
                      -|.|.|.|+.|++- -.||.||.+.++.+
T Consensus         6 ~RvF~~~gi~L~DP~p~~spe~V~dfYs~   34 (66)
T TIGR03738         6 SRVFTYNGVRLADPSPAMSPEQVRDFYSA   34 (66)
T ss_pred             EEEEEECCeEcCCCCCCCCHHHHHHHHhc
Confidence            36799999999888 88999999888865


No 21 
>PRK14036 citrate synthase; Provisional
Probab=63.63  E-value=6.6  Score=35.25  Aligned_cols=24  Identities=25%  Similarity=0.358  Sum_probs=20.0

Q ss_pred             eeeeecCChhHHhc-CCHHHHHHHH
Q 031653           24 KFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      ...|||++++||.+ .++||.+-|+
T Consensus        27 ~L~yRGy~i~dL~~~~~Feev~~LL   51 (377)
T PRK14036         27 ILEYRGYPIEELAEKSSFLETAYLL   51 (377)
T ss_pred             EEEECCccHHHHHccCCHHHHHHHH
Confidence            47899999999996 7899977654


No 22 
>cd06118 citrate_synt_like_1 Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle). Peroxisomal CS is involved in the glyoxylate cycle. This group also includes CS proteins which functions as a 2-methylcitrate synthase (2MCS). 2MCS catalyzes the condensation of propionyl-CoA (PrCoA) and OAA to form 2-methylcitrate and CoA during propionate metabolism. This group contains proteins which functions exclusively as either a CS or a 2MCS, as well as those with relaxed specificity which have dual functions as both a CS and a 2MCS. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and 
Probab=63.58  E-value=6  Score=34.96  Aligned_cols=24  Identities=29%  Similarity=0.563  Sum_probs=20.6

Q ss_pred             eeeeecCChhHHhc-CCHHHHHHHH
Q 031653           24 KFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      .-.|||+|++||.+ .++||.+-|+
T Consensus        22 ~l~YRG~~i~dL~~~~~feeva~LL   46 (358)
T cd06118          22 ILRYRGYDIEELAEKSSFEEVAYLL   46 (358)
T ss_pred             eEEECCccHHHHHhcCCHHHHHHHH
Confidence            48999999999996 7899987765


No 23 
>PF13543 KSR1-SAM:  SAM like domain present in kinase suppressor RAS 1
Probab=62.36  E-value=6.3  Score=30.86  Aligned_cols=22  Identities=36%  Similarity=0.676  Sum_probs=18.8

Q ss_pred             ecCChhHHhcCCHHHHHHHHHH
Q 031653           28 RGVDLDALLDMSNDELVKLFSA   49 (155)
Q Consensus        28 RG~~ld~L~~ms~eel~~L~~a   49 (155)
                      +..+||+|++||-+|+-+++..
T Consensus        89 ~~~tLe~Llemsd~el~~~l~~  110 (129)
T PF13543_consen   89 KVLTLEALLEMSDEELKEILNR  110 (129)
T ss_pred             hhcCHHHHHhCCHHHHHHHHHH
Confidence            3569999999999999888864


No 24 
>cd06115 AthCS_per_like Arabidopsis thaliana (Ath) peroxisomal (Per) CS_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. This group contains three Arabidopsis peroxisomal CS proteins, CYS1, -2, and -3 which are involved in the glyoxylate cycle. AthCYS1, in addition to a peroxisomal targeting sequence, has a predicted secretory signal peptide; it may be targeted to both the secretory pathway and the peroxisomes and is thought to be located in the extracellular matrix. AthCSY1 is expr
Probab=61.76  E-value=7.2  Score=35.52  Aligned_cols=24  Identities=21%  Similarity=0.386  Sum_probs=19.8

Q ss_pred             eeeeecCChhHHhc-CCHHHHHHHH
Q 031653           24 KFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      ...|||++++||.+ -+++|.+-||
T Consensus        48 ~L~YRGy~I~dLa~~~~feEv~~LL   72 (410)
T cd06115          48 ILRYRGYPIEELAEKSTFLEVAYLL   72 (410)
T ss_pred             eEEECCccHHHHHhcCCHHHHHHHH
Confidence            47899999999997 5788876654


No 25 
>PRK12351 methylcitrate synthase; Provisional
Probab=61.56  E-value=7.7  Score=34.94  Aligned_cols=26  Identities=23%  Similarity=0.423  Sum_probs=21.5

Q ss_pred             ceeeeeecCChhHHhc-CCHHHHHHHH
Q 031653           22 FKKFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        22 f~kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      .....|||++++||.+ -++||.+-||
T Consensus        29 ~g~L~YRGy~I~dLa~~~~feeva~LL   55 (378)
T PRK12351         29 GNDLHYRGYDILDLAEHCEFEEVAHLL   55 (378)
T ss_pred             CCEEEECCccHHHHHhcCCHHHHHHHH
Confidence            4579999999999996 6788877665


No 26 
>TIGR01798 cit_synth_I citrate synthase I (hexameric type). This model describes one of several distinct but closely homologous classes of citrate synthase, the protein that brings carbon (from acetyl-CoA) into the TCA cycle. This form, class I, is known to be hexameric and allosterically inhibited by NADH in Escherichia coli, Acinetobacter anitratum, Azotobacter vinelandii, Pseudomonas aeruginosa, etc. In most species with a class I citrate synthase, a dimeric class II isozyme is found. The class II enzyme may act primarily on propionyl-CoA to make 2-methylcitrate or be bifunctional, may be found among propionate utilization enzymes, and may be constitutive or induced by propionate. Some members of this model group as class I enzymes, and may be hexameric, but have shown regulatory properties more like class II enzymes.
Probab=61.17  E-value=7.6  Score=35.40  Aligned_cols=24  Identities=25%  Similarity=0.355  Sum_probs=19.8

Q ss_pred             eeeeecCChhHHhc-CCHHHHHHHH
Q 031653           24 KFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      ..+|||++++||.+ -++||.+-||
T Consensus        55 ~L~YRGy~I~dL~~~~~feEv~yLL   79 (412)
T TIGR01798        55 ILLYRGYPIDQLATKSDYLEVCYLL   79 (412)
T ss_pred             EEEECCccHHHHhccCCHHHHHHHH
Confidence            47999999999998 5788876654


No 27 
>PF00285 Citrate_synt:  Citrate synthase;  InterPro: IPR002020 Citrate synthase 2.3.3.1 from EC is a member of a small family of enzymes that can directly form a carbon-carbon bond without the presence of metal ion cofactors. It catalyses the first reaction in the Krebs' cycle, namely the conversion of oxaloacetate and acetyl-coenzyme A into citrate and coenzyme A. This reaction is important for energy generation and for carbon assimilation. The reaction proceeds via a non-covalently bound citryl-coenzyme A intermediate in a 2-step process (aldol-Claisen condensation followed by the hydrolysis of citryl-CoA).  Citrate synthase enzymes are found in two distinct structural types: type I enzymes (found in eukaryotes, Gram-positive bacteria and archaea) form homodimers and have shorter sequences than type II enzymes, which are found in Gram-negative bacteria and are hexameric in structure. In both types, the monomer is composed of two domains: a large alpha-helical domain consisting of two structural repeats, where the second repeat is interrupted by a small alpha-helical domain. The cleft between these domains forms the active site, where both citrate and acetyl-coenzyme A bind. The enzyme undergoes a conformational change upon binding of the oxaloacetate ligand, whereby the active site cleft closes over in order to form the acetyl-CoA binding site []. The energy required for domain closure comes from the interaction of the enzyme with the substrate. Type II enzymes possess an extra N-terminal beta-sheet domain, and some type II enzymes are allosterically inhibited by NADH []. This entry represents types I and II citrate synthase enzymes, as well as the related enzymes 2-methylcitrate synthase and ATP citrate synthase. 2-methylcitrate (2.3.3.5 from EC) synthase catalyses the conversion of oxaloacetate and propanoyl-CoA into (2R,3S)-2-hydroxybutane-1,2,3-tricarboxylate and coenzyme A. This enzyme is induced during bacterial growth on propionate, while type II hexameric citrate synthase is constitutive []. ATP citrate synthase (2.3.3.8 from EC) (also known as ATP citrate lyase) catalyses the MgATP-dependent, CoA-dependent cleavage of citrate into oxaloacetate and acetyl-CoA, a key step in the reductive tricarboxylic acid pathway of CO2 assimilation used by a variety of autotrophic bacteria and archaea to fix carbon dioxide []. ATP citrate synthase is composed of two distinct subunits. In eukaryotes, ATP citrate synthase is a homotetramer of a single large polypeptide, and is used to produce cytosolic acetyl-CoA from mitochondrial produced citrate [].; GO: 0046912 transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer, 0044262 cellular carbohydrate metabolic process; PDB: 2C6X_D 3L96_B 1OWB_B 1NXG_A 1K3P_A 1OWC_B 3L97_B 1NXE_A 3L98_A 3L99_A ....
Probab=60.91  E-value=5.4  Score=35.10  Aligned_cols=23  Identities=30%  Similarity=0.624  Sum_probs=20.0

Q ss_pred             eeeecCChhHHhc-CCHHHHHHHH
Q 031653           25 FSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        25 FtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      -.|||++++||.+ -++||.+-||
T Consensus        22 L~YRGy~i~dL~~~~sfeeva~LL   45 (356)
T PF00285_consen   22 LRYRGYDIEDLAENASFEEVAYLL   45 (356)
T ss_dssp             EEETTEEHHHHHHHSBHHHHHHHH
T ss_pred             EEEcCeEHHHHHhcCCHHHHHHHH
Confidence            7899999999999 7788877665


No 28 
>PRK14037 citrate synthase; Provisional
Probab=60.84  E-value=7.9  Score=34.75  Aligned_cols=23  Identities=26%  Similarity=0.600  Sum_probs=19.5

Q ss_pred             eeeecCChhHHhc-CCHHHHHHHH
Q 031653           25 FSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        25 FtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      ..|||++++||.. .+++|.+-|+
T Consensus        28 L~yRGy~i~dL~~~~~Feev~~LL   51 (377)
T PRK14037         28 LRYRGYNIEDLVNYGSYEETIYLM   51 (377)
T ss_pred             EEECCccHHHHHccCCHHHHHHHH
Confidence            7899999999994 7898876654


No 29 
>PRK14033 citrate synthase; Provisional
Probab=60.64  E-value=8.1  Score=34.63  Aligned_cols=24  Identities=25%  Similarity=0.465  Sum_probs=20.0

Q ss_pred             eeeeecCChhHHhc-CCHHHHHHHH
Q 031653           24 KFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      ...|||+|++||.+ .++||.+-|+
T Consensus        32 ~L~yRG~di~dLa~~~sfeeva~LL   56 (375)
T PRK14033         32 SLTYRGYPVQDLAARCSFEEVAYLL   56 (375)
T ss_pred             eEEECCccHHHHHhcCCHHHHHHHH
Confidence            47899999999996 7899977654


No 30 
>cd06117 Ec2MCS_like_1 Subgroup of Escherichia coli (Ec) 2-methylcitrate synthase (2MCS)_like. 2MCS catalyzes the condensation of propionyl-coenzyme A (PrCoA) and oxalacetate (OAA) to form 2-methylcitrate and coenzyme A (CoA) during propionate metabolism. Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and OAA to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). This group contains proteins similar to the E. coli 2MCS, EcPrpC.  EcPrpC is one of two CS isozymes in the gram-negative E. coli. EcPrpC is a dimeric (type I ) CS; it is induced during growth on propionate and prefers PrCoA as a substrate, but has a partial CS activity with AcCoA. This group also includes Salmonella typhimurium PrpC and Ralstonia eutropha (Re) 2-MCS1 which are also induced during growth on propionate, prefer PrCoA as substrate, but can also can use AcCoA. Re 2-MCS1 at a low rate can use butyryl-CoA and valeryl-CoA. A second Ralstonia eu
Probab=60.22  E-value=8.3  Score=34.48  Aligned_cols=25  Identities=24%  Similarity=0.480  Sum_probs=20.4

Q ss_pred             eeeeeecCChhHHh-cCCHHHHHHHH
Q 031653           23 KKFSFRGVDLDALL-DMSNDELVKLF   47 (155)
Q Consensus        23 ~kFtYRG~~ld~L~-~ms~eel~~L~   47 (155)
                      -...|||++++||. .-++||.+-|+
T Consensus        21 g~L~YRGy~i~dLa~~~~FEeva~LL   46 (366)
T cd06117          21 NDLHYRGYDILDLAEKCEFEEVAHLL   46 (366)
T ss_pred             CEEEECCccHHHHHhcCCHHHHHHHH
Confidence            36899999999997 45799977665


No 31 
>cd06107 EcCS_AthCS-per_like Escherichia coli (Ec) citrate synthase (CS) gltA and Arabidopsis thaliana (Ath) peroxisomal (Per) CS_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA.   There are two types of CSs: type I CS and type II CSs.  Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homodimers with both subunits participating in the active site.  Type II CSs are unique to gram-negative bacteria and are homohexamers of ide
Probab=60.12  E-value=7.9  Score=34.85  Aligned_cols=24  Identities=25%  Similarity=0.483  Sum_probs=19.2

Q ss_pred             eeeeecCChhHHhcCC-HHHHHHHH
Q 031653           24 KFSFRGVDLDALLDMS-NDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~ms-~eel~~L~   47 (155)
                      ...|||++++||.+-+ +||.+-||
T Consensus        28 ~L~YRGy~I~dLa~~~~feev~yLL   52 (382)
T cd06107          28 ILLYRGYPIEQLAESSTYEEVAYLL   52 (382)
T ss_pred             eEEECCccHHHHHhcCCHHHHHHHH
Confidence            4799999999999664 77766554


No 32 
>cd06111 DsCS_like Cold-active citrate synthase (CS) from an Antarctic bacterial strain DS2-3R (Ds)-like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). 2-methylcitrate synthase (2MCS) catalyzes the condensation of propionyl-coenzyme A (PrCoA) and OAA to form 2-methylcitrate and coenzyme A (CoA) during propionate metabolism. The overall CS reaction is thought to proceed through three partial reactions: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. DsCS, compared with CS from the hyperthermophile Pyrococcus furiosus (not included in this group), has an increase in the size of surface loops, a higher proline content in the loop regions, a more accessible active site, and a highe
Probab=59.82  E-value=8.5  Score=34.28  Aligned_cols=24  Identities=25%  Similarity=0.499  Sum_probs=19.8

Q ss_pred             eeeeecCChhHHh-cCCHHHHHHHH
Q 031653           24 KFSFRGVDLDALL-DMSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~-~ms~eel~~L~   47 (155)
                      ...|||+|++||. +.++||.+-|+
T Consensus        22 ~L~yRG~di~dLa~~~~feeva~LL   46 (362)
T cd06111          22 SLTYRGYPVQDLAENCSFEEVAYLL   46 (362)
T ss_pred             eEEECCccHHHHHccCCHHHHHHHH
Confidence            4789999999999 55899977654


No 33 
>TIGR01800 cit_synth_II 2-methylcitrate synthase/citrate synthase II. Members of this family are dimeric enzymes with activity as 2-methylcitrate synthase, citrate synthase, or both. Many Gram-negative species have a hexameric citrate synthase, termed citrate synthase I (TIGR01798). Members of this family (TIGR01800) appear as a second citrate synthase isozyme but typically are associated with propionate metabolism and synthesize 2-methylcitrate from propionyl-CoA; citrate synthase activity may be incidental. A number of species, including Thermoplasma acidophilum, Pyrococcus furiosus, and the Antarctic bacterium DS2-3R have a bifunctional member of this family as the only citrate synthase isozyme.
Probab=59.71  E-value=7.9  Score=34.49  Aligned_cols=23  Identities=30%  Similarity=0.648  Sum_probs=19.7

Q ss_pred             eeeecCChhHHhc-CCHHHHHHHH
Q 031653           25 FSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        25 FtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      ..|||+|++||.+ .++||.+-|+
T Consensus        23 l~yRG~~i~dL~~~~~feeva~LL   46 (368)
T TIGR01800        23 LTYRGYDIEDLAEHASFEEVAYLL   46 (368)
T ss_pred             EEECCeeHHHHHhcCCHHHHHHHH
Confidence            7899999999995 7899987654


No 34 
>PLN02456 citrate synthase
Probab=59.28  E-value=8.4  Score=35.59  Aligned_cols=24  Identities=25%  Similarity=0.490  Sum_probs=19.8

Q ss_pred             eeeeecCChhHHhc-CCHHHHHHHH
Q 031653           24 KFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      ...|||++++||.+ .++||.+-||
T Consensus        87 ~L~YRGy~I~dLa~~~~feevayLL  111 (455)
T PLN02456         87 ILRFRGYPIEELAEKSPFEEVAYLL  111 (455)
T ss_pred             EEEECCccHHHHHhcCCHHHHHHHH
Confidence            46999999999997 6788877664


No 35 
>cd06110 BSuCS-II_like Bacillus subtilis (Bs) citrate synthase (CS)-II_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). 2MCS catalyzes the condensation of propionyl-coenzyme A (PrCoA) and OAA to form 2-methylcitrate and CoA during propionate metabolism. The overall CS reaction is thought to proceed through three partial reactions: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. This group contains proteins similar to BsCS-II, the major CS of the gram-positive bacterium Bacillus subtilis. A mutation in the gene which encodes BsCS-II (citZ gene) has been described which resulted in a significant loss of CS activity, partial glutamate auxotrophy, and a sporulation deficiency, a
Probab=59.08  E-value=8.3  Score=34.10  Aligned_cols=23  Identities=26%  Similarity=0.547  Sum_probs=19.5

Q ss_pred             eeeecCChhHHhc-CCHHHHHHHH
Q 031653           25 FSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        25 FtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      ..|||+|++||.. .++||.+-|+
T Consensus        23 L~yRG~di~dL~~~~~feeva~LL   46 (356)
T cd06110          23 LIYRGYDIHDLAENSTFEEVAYLL   46 (356)
T ss_pred             EEECCeeHHHHHhcCCHHHHHHHH
Confidence            6899999999995 7899987654


No 36 
>PRK12349 citrate synthase 3; Provisional
Probab=59.02  E-value=8.9  Score=34.27  Aligned_cols=24  Identities=25%  Similarity=0.354  Sum_probs=20.2

Q ss_pred             eeeeecCChhHHhc-CCHHHHHHHH
Q 031653           24 KFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      ...|||+|++||.+ .|+||.+-|+
T Consensus        28 ~L~YRGydi~dLa~~~sFeeva~LL   52 (369)
T PRK12349         28 EIVIQGYDLIELSKTKEYLDIVHLL   52 (369)
T ss_pred             EEEECCccHHHHHccCCHHHHHHHH
Confidence            48999999999996 5799977665


No 37 
>cd06112 citrate_synt_like_1_1 Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle). Peroxisomal CS is involved in the glyoxylate cycle. This group also includes CS proteins which functions as a 2-methylcitrate synthase (2MCS). 2MCS catalyzes the condensation of propionyl-CoA (PrCoA) and OAA to form 2-methylcitrate and CoA during propionate metabolism. This group contains proteins which functions exclusively as either a CS or a 2MCS, as well as those with relaxed specificity which have dual functions as both a CS and a 2MCS. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, an
Probab=58.83  E-value=9.1  Score=34.26  Aligned_cols=24  Identities=29%  Similarity=0.569  Sum_probs=19.9

Q ss_pred             eeeeecCChhHHhc-CCHHHHHHHH
Q 031653           24 KFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      ...|||++++||.. .+.||.+-|+
T Consensus        24 ~L~yRGy~i~dL~~~~~Feev~~LL   48 (373)
T cd06112          24 ILEYRGYDIEELAEYSSFEEVALLL   48 (373)
T ss_pred             EEEECCccHHHHhcCCCHHHHHHHH
Confidence            47999999999996 5788877654


No 38 
>PRK09569 type I citrate synthase; Reviewed
Probab=58.63  E-value=7.3  Score=35.83  Aligned_cols=23  Identities=13%  Similarity=0.374  Sum_probs=18.9

Q ss_pred             eeeecCChhHHhcC----------CHHHHHHHH
Q 031653           25 FSFRGVDLDALLDM----------SNDELVKLF   47 (155)
Q Consensus        25 FtYRG~~ld~L~~m----------s~eel~~L~   47 (155)
                      -.|||++++||.+-          ++||.+-||
T Consensus        61 l~YRGy~I~dL~~~~p~~~~~~~~~fEev~~LL   93 (437)
T PRK09569         61 IRFRGKTIPETFEALPKAPGSEYPTVESFWYFL   93 (437)
T ss_pred             eeECCccHHHHHhhCccccccCCCCHHHHHHHH
Confidence            47999999999977          678876664


No 39 
>PRK14035 citrate synthase; Provisional
Probab=57.65  E-value=9.5  Score=34.24  Aligned_cols=24  Identities=29%  Similarity=0.621  Sum_probs=20.4

Q ss_pred             eeeeecCChhHHhc-CCHHHHHHHH
Q 031653           24 KFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      +..|||++++||.+ -++||.+-|+
T Consensus        24 ~L~YRGy~i~dLa~~~~Feeva~LL   48 (371)
T PRK14035         24 QLTYAGYDIDDLAENASFEEVIFLL   48 (371)
T ss_pred             EeEECCccHHHHHhcCCHHHHHHHH
Confidence            48999999999997 5789987665


No 40 
>cd06114 EcCS_like Escherichia coli (Ec) citrate synthase (CS) GltA_like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA.  There are two types of CSs: type I CS and type II CSs.  Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homodimers with both subunits participating in the active site.  Type II CSs are unique to gram-negative bacteria and are homohexamers of identical subunits (approximated as a trimer of dimers).  Some typ
Probab=57.30  E-value=9.8  Score=34.45  Aligned_cols=24  Identities=25%  Similarity=0.391  Sum_probs=20.2

Q ss_pred             eeeeecCChhHHhc-CCHHHHHHHH
Q 031653           24 KFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      ...|||++++||.+ -++||.+-||
T Consensus        50 ~L~YRGy~i~dLa~~~sfEEva~LL   74 (400)
T cd06114          50 ILRYRGYPIEQLAEKSSFLEVCYLL   74 (400)
T ss_pred             EEEECCccHHHHHhcCCHHHHHHHH
Confidence            47899999999997 5789977665


No 41 
>PRK14032 citrate synthase; Provisional
Probab=56.26  E-value=9.5  Score=35.14  Aligned_cols=24  Identities=29%  Similarity=0.559  Sum_probs=19.4

Q ss_pred             eeeeecCChhHHhcC-------CHHHHHHHH
Q 031653           24 KFSFRGVDLDALLDM-------SNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~m-------s~eel~~L~   47 (155)
                      ..+|||++++||.+-       ++||.+-||
T Consensus        67 ~L~YRGy~I~dLa~~~~~~~~~~FeEv~~LL   97 (447)
T PRK14032         67 KLYYRGYDIKDLVNGFLKEKRFGFEEVAYLL   97 (447)
T ss_pred             ceeECCccHHHHHhhcccccCCCHHHHHHHH
Confidence            389999999999977       788865553


No 42 
>PRK05614 gltA type II citrate synthase; Reviewed
Probab=55.64  E-value=9.6  Score=34.78  Aligned_cols=24  Identities=21%  Similarity=0.342  Sum_probs=20.1

Q ss_pred             eeeeecCChhHHhc-CCHHHHHHHH
Q 031653           24 KFSFRGVDLDALLD-MSNDELVKLF   47 (155)
Q Consensus        24 kFtYRG~~ld~L~~-ms~eel~~L~   47 (155)
                      ...|||++++||.+ -++||.+-||
T Consensus        68 ~L~YRGy~i~dLa~~~~feEva~LL   92 (419)
T PRK05614         68 ILLYRGYPIEQLAEKSDFLEVCYLL   92 (419)
T ss_pred             EEEECCccHHHHHhcCCHHHHHHHH
Confidence            47899999999998 5788877765


No 43 
>PRK06224 citrate synthase; Provisional
Probab=54.86  E-value=12  Score=31.75  Aligned_cols=23  Identities=30%  Similarity=0.479  Sum_probs=18.4

Q ss_pred             eeeeecCChhHH-hcCCHHHHHHH
Q 031653           24 KFSFRGVDLDAL-LDMSNDELVKL   46 (155)
Q Consensus        24 kFtYRG~~ld~L-~~ms~eel~~L   46 (155)
                      +..|||++++|| .++|++|..=|
T Consensus        20 ~l~yrG~~~~dL~~~~sf~e~~~l   43 (263)
T PRK06224         20 EIYVRGYDLEDLIGKLSFTDMIFL   43 (263)
T ss_pred             eeEECCccHHHHhhcCCHHHHHHH
Confidence            489999999999 47888885443


No 44 
>PRK00635 excinuclease ABC subunit A; Provisional
Probab=48.47  E-value=16  Score=39.32  Aligned_cols=33  Identities=15%  Similarity=0.413  Sum_probs=27.5

Q ss_pred             eeeeeecCChhHHhcCCHHHHHHHHHH--HHHhhh
Q 031653           23 KKFSFRGVDLDALLDMSNDELVKLFSA--RARRRF   55 (155)
Q Consensus        23 ~kFtYRG~~ld~L~~ms~eel~~L~~a--r~RR~~   55 (155)
                      -+.+|+|+++.|+++|+.+|.++.|..  +..+.+
T Consensus      1646 L~v~~~gk~I~dvL~mtv~ea~~~F~~~~~i~~~L 1680 (1809)
T PRK00635       1646 QEVVYEGKHFGQLLQTPIEEVAETFPFLKKIQKPL 1680 (1809)
T ss_pred             HhheeCCCCHHHHhcCCHHHHHHHhhccHHHHHHH
Confidence            458999999999999999999999965  445544


No 45 
>cd06105 ScCit1-2_like Saccharomyces cerevisiae (Sc) citrate synthases Cit1-2_like. Citrate synthases (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) with oxaloacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). Some CS proteins function as 2-methylcitrate synthase (2MCS). 2MCS catalyzes the condensation of propionyl-coenzyme A (PrCoA) and OAA to form 2-methylcitrate and CoA during propionate metabolism. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. There are two types of CSs: type I CS and type II CSs.  Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-neg
Probab=44.99  E-value=17  Score=33.46  Aligned_cols=23  Identities=22%  Similarity=0.424  Sum_probs=18.1

Q ss_pred             eeeecCChhHHhcCC----------HHHHHHHH
Q 031653           25 FSFRGVDLDALLDMS----------NDELVKLF   47 (155)
Q Consensus        25 FtYRG~~ld~L~~ms----------~eel~~L~   47 (155)
                      -.|||++++||.+-+          .||++-||
T Consensus        59 l~YRGy~I~dLa~~~~~~~~~~~~~fEev~yLL   91 (427)
T cd06105          59 IRFRGLSIPECQKLLPKAPGGEEPLPEGLFWLL   91 (427)
T ss_pred             eEECCccHHHHHhhCcccccccccCHHHHHHHH
Confidence            479999999998754          67876664


No 46 
>cd06103 ScCS-like Saccharomyces cerevisiae (Sc) citrate synthase (CS)-like. CS catalyzes the condensation of acetyl coenzyme A (AcCoA) with oxaloacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the citric acid cycle (TCA or Krebs cycle). Some CS proteins function as 2-methylcitrate synthase (2MCS). 2MCS catalyzes the condensation of propionyl-coenzyme A (PrCoA) and OAA to form 2-methylcitrate and CoA during propionate metabolism. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. There are two types of CSs: type I CS and type II CSs.  Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homo
Probab=44.76  E-value=17  Score=33.38  Aligned_cols=22  Identities=23%  Similarity=0.401  Sum_probs=17.9

Q ss_pred             eeecCChhHHhcCC----------HHHHHHHH
Q 031653           26 SFRGVDLDALLDMS----------NDELVKLF   47 (155)
Q Consensus        26 tYRG~~ld~L~~ms----------~eel~~L~   47 (155)
                      .|||++++||.+-+          +||.+-||
T Consensus        60 ~YRGy~I~dLa~~~~~~~~~~~~~fEev~yLL   91 (426)
T cd06103          60 RFRGKTIPECQELLPKADGGGEPLPEGLFWLL   91 (426)
T ss_pred             EECCccHHHHHhhCccccccCcCcHHHHHHHH
Confidence            69999999999863          78876664


No 47 
>cd06102 citrate_synt_like_2 Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) and oxalacetate (OAA) to form citrate and coenzyme A (CoA), the first step in the oxidative citric acid cycle (TCA or Krebs cycle). Peroxisomal CS is involved in the glyoxylate cycle. This group also includes CS proteins which functions as a 2-methylcitrate synthase (2MCS). 2MCS catalyzes the condensation of propionyl-CoA (PrCoA) and OAA to form 2-methylcitrate and CoA during propionate metabolism. This group contains proteins which functions exclusively as either a CS or a 2MCS, as well as those with relaxed specificity which have dual functions as both a CS and a 2MCS. The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and 
Probab=41.33  E-value=24  Score=30.61  Aligned_cols=26  Identities=23%  Similarity=0.346  Sum_probs=21.6

Q ss_pred             eeeeeecCChhHHh-cCCHHHHHHHHH
Q 031653           23 KKFSFRGVDLDALL-DMSNDELVKLFS   48 (155)
Q Consensus        23 ~kFtYRG~~ld~L~-~ms~eel~~L~~   48 (155)
                      ....|||+|+.||. +.++||.+.|+=
T Consensus        31 ~~~~yRG~da~~L~~~~~~e~va~LLw   57 (282)
T cd06102          31 GRLFYRGRDAVELAETATLEEVAALLW   57 (282)
T ss_pred             CeeEEcCccHHHHHhcCCHHHHHHHHH
Confidence            34789999999987 788999888753


No 48 
>cd06106 ScCit3_like Saccharomyces cerevisiae (Sc) 2-methylcitrate synthase Cit3-like. 2-methylcitrate synthase (2MCS) catalyzes the condensation of propionyl-coenzyme A (PrCoA) and oxaloacetate (OAA) to form 2-methylcitrate and CoA. Citrate synthase (CS) catalyzes the condensation of acetyl coenzyme A (AcCoA) with OAA to form citrate and CoA, the first step in the citric acid cycle (TCA or Krebs cycle). The overall CS reaction is thought to proceed through three partial reactions and involves both closed and open conformational forms of the enzyme: a) the carbanion or equivalent is generated from AcCoA by base abstraction of a proton, b) the nucleophilic attack of this carbanion on OAA to generate citryl-CoA, and c) the hydrolysis of citryl-CoA to produce citrate and CoA. There are two types of CSs: type I CS and type II CSs.  Type I CSs are found in eukarya, gram-positive bacteria, archaea, and in some gram-negative bacteria and are homodimers with both subunits participating in the a
Probab=40.06  E-value=20  Score=32.97  Aligned_cols=23  Identities=13%  Similarity=0.274  Sum_probs=17.7

Q ss_pred             eeeecCChhHHhcC--------CH--HHHHHHH
Q 031653           25 FSFRGVDLDALLDM--------SN--DELVKLF   47 (155)
Q Consensus        25 FtYRG~~ld~L~~m--------s~--eel~~L~   47 (155)
                      -.|||++++||.+-        ++  ||.+-|+
T Consensus        59 l~YRGy~I~dLa~~~~~~~~~~~f~~Eev~yLL   91 (428)
T cd06106          59 IRFHGKTIPECQKELPKAPIGGEMLPESMLWLL   91 (428)
T ss_pred             eeECCCcHHHHHhhCccccccCCccHHHHHHHH
Confidence            46999999999885        44  7766654


No 49 
>PF14454 Prok_Ub:  Prokaryotic Ubiquitin
Probab=36.75  E-value=24  Score=24.63  Aligned_cols=28  Identities=21%  Similarity=0.479  Sum_probs=21.9

Q ss_pred             ceeeeeecCChhH-HhcCCHHHHHHHHHH
Q 031653           22 FKKFSFRGVDLDA-LLDMSNDELVKLFSA   49 (155)
Q Consensus        22 f~kFtYRG~~ld~-L~~ms~eel~~L~~a   49 (155)
                      -|.|.|-|++|++ =-+||-||+..++.+
T Consensus         7 ~R~F~~~g~~L~DP~p~~spe~V~~~ya~   35 (65)
T PF14454_consen    7 TRVFRYNGITLPDPNPSLSPEEVRDFYAA   35 (65)
T ss_pred             EEEEEECCEECCCCCCCCCHHHHHHHHhh
Confidence            3678999999887 458999998777654


No 50 
>PF05361 PP1_inhibitor:  PKC-activated protein phosphatase-1 inhibitor;  InterPro: IPR008025 Contractility of vascular smooth muscle depends on phosphorylation of myosin light chains, and is modulated by hormonal control of myosin phosphatase activity. Signaling pathways activate kinases such as PKC or Rho-dependent kinases that phosphorylate the myosin phosphatase inhibitor protein called CPI-17. Phosphorylation of CPI-17 at Thr-38 enhances its inhibitory potency 1000-fold, creating a molecular switch for regulating contraction [].; GO: 0042325 regulation of phosphorylation, 0005737 cytoplasm; PDB: 2RLT_A 1J2M_A 1K5O_A 1J2N_A.
Probab=35.54  E-value=13  Score=29.86  Aligned_cols=40  Identities=35%  Similarity=0.590  Sum_probs=22.9

Q ss_pred             cCChhHHhcCCHHHHHHHHHHHHHhh-hh-----cCCCCCcc--hHHHHHHHhhhc
Q 031653           29 GVDLDALLDMSNDELVKLFSARARRR-FQ-----RGLKRKPM--ALIKKLRKAKRE   76 (155)
Q Consensus        29 G~~ld~L~~ms~eel~~L~~ar~RR~-~~-----Rgl~k~~~--~Llkklrkak~~   76 (155)
                      -+|+|+|++|+.|+        +|++ +.     .+-....|  .||.+++...+.
T Consensus        73 EIDIDeLLDl~sde--------eR~~~LqelL~~C~~ptE~FI~ELL~kLkgL~k~  120 (144)
T PF05361_consen   73 EIDIDELLDLESDE--------ERRRKLQELLQDCPKPTEDFIQELLSKLKGLRKL  120 (144)
T ss_dssp             SSHHHHHHCTSSTT--------HHHHHHHHHHTTCSSTTHHHHHHHHHHCTTT---
T ss_pred             cccHHHHhcCCchH--------HHHHHHHHHHhhcCCCHHHHHHHHHHHHHhhhcC
Confidence            36889999999887        5555 32     12222223  677777665543


No 51 
>PF12936 Kri1_C:  KRI1-like family C-terminal;  InterPro: IPR024626 The yeast member of the Kri1-like family (Kri1p) is found to be required for 40S ribosome biogenesis in the nucleolus []. This entry represents the C-terminal domain of this protein family.
Probab=33.89  E-value=45  Score=24.62  Aligned_cols=30  Identities=23%  Similarity=0.463  Sum_probs=24.5

Q ss_pred             ceeeeee-------cCChhHHhcCCHHHHHHHHHHHH
Q 031653           22 FKKFSFR-------GVDLDALLDMSNDELVKLFSARA   51 (155)
Q Consensus        22 f~kFtYR-------G~~ld~L~~ms~eel~~L~~ar~   51 (155)
                      -..|.||       |.|.+|+|.++-.||-+.++-..
T Consensus        26 p~RFkYr~V~p~~fGLt~~eIL~adDkeLNq~vsLKk   62 (93)
T PF12936_consen   26 PTRFKYREVPPNSFGLTTEEILMADDKELNQWVSLKK   62 (93)
T ss_pred             CCceeeeecCcccCCCCHHHHHhCCHHHHHHHhhHHh
Confidence            3459998       78999999999999988887543


No 52 
>TIGR00630 uvra excinuclease ABC, A subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=33.26  E-value=36  Score=34.19  Aligned_cols=27  Identities=26%  Similarity=0.585  Sum_probs=23.8

Q ss_pred             eeeeeecCChhHHhcCCHHHHHHHHHH
Q 031653           23 KKFSFRGVDLDALLDMSNDELVKLFSA   49 (155)
Q Consensus        23 ~kFtYRG~~ld~L~~ms~eel~~L~~a   49 (155)
                      -+.+|+|+++.|+++|+.+|..+.+..
T Consensus       775 l~v~~~g~~i~dvl~~tv~e~~~f~~~  801 (924)
T TIGR00630       775 LEVKYKGKNIADVLDMTVEEAYEFFEA  801 (924)
T ss_pred             HhceeCCCCHHHHhCCcHHHHHHHHHh
Confidence            458999999999999999998888753


No 53 
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=32.13  E-value=28  Score=23.02  Aligned_cols=49  Identities=22%  Similarity=0.375  Sum_probs=28.4

Q ss_pred             HHHHhhhhcCCCCCcchHHHHHHHhhhcCCCCCCCCceEeccCCceecccccccEEEEecCCccccc
Q 031653           49 ARARRRFQRGLKRKPMALIKKLRKAKREAPPGEKPEPVRTHLRNMIIVPEMIGSIIGVYNGKTFNQV  115 (155)
Q Consensus        49 ar~RR~~~Rgl~k~~~~Llkklrkak~~~~~~~kp~~ikt~~R~~~IlP~mvG~~v~VyNGK~f~~v  115 (155)
                      |+.|++++|+.|+-     +             .|..+.--.=....+|-.|-..-|.|+|++.+.|
T Consensus         8 Sksr~~~Rrs~~~l-----~-------------~~~l~~c~~cg~~~~~H~vc~~cG~y~~r~v~~~   56 (56)
T PF01783_consen    8 SKSRKRMRRSHWKL-----K-------------APNLVKCPNCGEPKLPHRVCPSCGYYKGRQVIEV   56 (56)
T ss_dssp             CHHHHHHHTTTTS--------------------TTSEEESSSSSSEESTTSBCTTTBBSSSSSSST-
T ss_pred             ChhHccchhccccc-----c-------------ccceeeeccCCCEecccEeeCCCCeECCEEEeeC
Confidence            46788888887722     1             1112222223345677777655579999987754


No 54 
>smart00540 LEM in nuclear membrane-associated proteins. LEM, domain in nuclear membrane-associated proteins, including lamino-associated polypeptide 2 and emerin.
Probab=28.63  E-value=1.1e+02  Score=19.78  Aligned_cols=35  Identities=37%  Similarity=0.430  Sum_probs=23.5

Q ss_pred             hHHhcCCHHHHHHHHHHHHHhhhhcCCCCCcc------hHHHHHHHhh
Q 031653           33 DALLDMSNDELVKLFSARARRRFQRGLKRKPM------ALIKKLRKAK   74 (155)
Q Consensus        33 d~L~~ms~eel~~L~~ar~RR~~~Rgl~k~~~------~Llkklrkak   74 (155)
                      +++..+|.+||       .+.-..-|+..+|.      .+.+||.++.
T Consensus         1 ~d~~~LSd~eL-------~~~L~~~G~~~gPIt~sTR~vy~kkL~~~~   41 (44)
T smart00540        1 DDVDRLSDAEL-------RAELKQYGLPPGPITDTTRKLYEKKLRKLR   41 (44)
T ss_pred             CchhHcCHHHH-------HHHHHHcCCCCCCcCcchHHHHHHHHHHHH
Confidence            35677888887       44445679999995      4566676543


No 55 
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair]
Probab=28.29  E-value=50  Score=33.51  Aligned_cols=35  Identities=23%  Similarity=0.510  Sum_probs=27.7

Q ss_pred             cceeeeeecCChhHHhcCCHHHHHHHHHHH--HHhhh
Q 031653           21 TFKKFSFRGVDLDALLDMSNDELVKLFSAR--ARRRF   55 (155)
Q Consensus        21 tf~kFtYRG~~ld~L~~ms~eel~~L~~ar--~RR~~   55 (155)
                      .-=+.+|+|+++.+.|+|+.||-.+.|.+-  ..|++
T Consensus       767 EtLev~ykGK~IadVL~MTveEA~~FF~~~p~I~rkL  803 (935)
T COG0178         767 ETLEVKYKGKNIADVLDMTVEEALEFFEAIPKIARKL  803 (935)
T ss_pred             ceEEEEECCccHHHHHhccHHHHHHHHhcchHHHHHH
Confidence            344689999999999999999988888763  34544


No 56 
>PF06528 Phage_P2_GpE:  Phage P2 GpE;  InterPro: IPR009493 This entry is represented by Burkholderia phage phiE202, Gp27. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This family consists of several phage and bacterial proteins which are closely related to the GpE tail protein from Phage P2.
Probab=27.53  E-value=1e+02  Score=19.48  Aligned_cols=20  Identities=25%  Similarity=0.106  Sum_probs=16.0

Q ss_pred             cCChhHHhcCCHHHHHHHHH
Q 031653           29 GVDLDALLDMSNDELVKLFS   48 (155)
Q Consensus        29 G~~ld~L~~ms~eel~~L~~   48 (155)
                      |-+.+++..||++||+.-..
T Consensus         9 hW~Pse~~~m~l~El~~Wre   28 (39)
T PF06528_consen    9 HWPPSEMDAMSLDELMDWRE   28 (39)
T ss_pred             CCCHHHHhcCCHHHHHHHHH
Confidence            45789999999999876543


No 57 
>PRK01110 rpmF 50S ribosomal protein L32; Validated
Probab=26.55  E-value=40  Score=22.88  Aligned_cols=21  Identities=19%  Similarity=0.442  Sum_probs=16.6

Q ss_pred             eecccccccEEEEecCCccccc
Q 031653           94 IIVPEMIGSIIGVYNGKTFNQV  115 (155)
Q Consensus        94 ~IlP~mvG~~v~VyNGK~f~~v  115 (155)
                      .++|--|-. -|.|+|++.+.+
T Consensus        36 ~~~pH~vc~-cG~Y~gr~v~~~   56 (60)
T PRK01110         36 YHLPHHVSP-KGYYKGRKVLKK   56 (60)
T ss_pred             eeccceecC-CcccCCeEeecc
Confidence            477777766 889999988764


No 58 
>TIGR01793 cit_synth_euk citrate (Si)-synthase, eukaryotic. This model includes both mitochondrial and peroxisomal forms of citrate synthase. Citrate synthase is the entry point to the TCA cycle from acetyl-CoA. Peroxisomal forms, such as SP:P08679 from yeast (recognized by the C-terminal targeting motif SKL) act in the glyoxylate cycle. Eukaryotic homologs excluded by the high trusted cutoff of this model include a Tetrahymena thermophila citrate synthase that doubles as a filament protein, a putative citrate synthase from Plasmodium falciparum (no TCA cycle), and a methylcitrate synthase from Aspergillus nidulans.
Probab=26.46  E-value=52  Score=30.30  Aligned_cols=23  Identities=22%  Similarity=0.430  Sum_probs=16.5

Q ss_pred             eeeecCChhHHhc----CC------HHHHHHHH
Q 031653           25 FSFRGVDLDALLD----MS------NDELVKLF   47 (155)
Q Consensus        25 FtYRG~~ld~L~~----ms------~eel~~L~   47 (155)
                      -.|||++++||++    -+      .||++-||
T Consensus        62 l~yRGy~I~dl~~~~~~~~~~~~~~fEev~~LL   94 (427)
T TIGR01793        62 IRFRGLSIPECQKLLPKAKGGEEPLPEGLLWLL   94 (427)
T ss_pred             eEECCeeHHHHHHHhccCCccccCCHHHHHHHH
Confidence            5799999999843    33      57766554


No 59 
>PF08921 DUF1904:  Domain of unknown function (DUF1904);  InterPro: IPR015017 This entry represents a family of hypothetical bacterial proteins. ; PDB: 1U9D_B.
Probab=25.63  E-value=37  Score=25.51  Aligned_cols=27  Identities=26%  Similarity=0.609  Sum_probs=19.5

Q ss_pred             eeeecCChhHHhcCCH---HHHHHHHHHHH
Q 031653           25 FSFRGVDLDALLDMSN---DELVKLFSARA   51 (155)
Q Consensus        25 FtYRG~~ld~L~~ms~---eel~~L~~ar~   51 (155)
                      ..+||++-+++..+|-   |+|++|+.+.+
T Consensus         4 lr~rGi~~e~v~~~S~~LideLa~i~~~p~   33 (108)
T PF08921_consen    4 LRFRGIEEEQVQELSKELIDELAEICGCPR   33 (108)
T ss_dssp             EEEESS-HHHHHHHHHHHHHHHHHHHT--G
T ss_pred             EEEecCCHHHHHHHhHHHHHHHHHHHCCCc
Confidence            4689999999999985   67888776643


No 60 
>cd00166 SAM Sterile alpha motif.; Widespread domain in signalling and nuclear proteins. In EPH-related tyrosine kinases, appears to mediate cell-cell initiated signal transduction via the binding of SH2-containing proteins to a conserved tyrosine that is phosphorylated. In many cases mediates homodimerization.
Probab=25.34  E-value=54  Score=20.28  Aligned_cols=19  Identities=37%  Similarity=0.630  Sum_probs=15.0

Q ss_pred             ecCChhHHhcCCHHHHHHH
Q 031653           28 RGVDLDALLDMSNDELVKL   46 (155)
Q Consensus        28 RG~~ld~L~~ms~eel~~L   46 (155)
                      .|+|.+.|+.|+.++|.++
T Consensus        26 ~~i~g~~L~~l~~~dL~~l   44 (63)
T cd00166          26 NGIDGDLLLLLTEEDLKEL   44 (63)
T ss_pred             cCCCHHHHhHCCHHHHHHc
Confidence            4678999999999887643


No 61 
>PF09597 IGR:  IGR protein motif;  InterPro: IPR019083  This entry is found in fungal and plant proteins and contains a conserved IGR motif. Its function is unknown. 
Probab=25.02  E-value=46  Score=22.60  Aligned_cols=25  Identities=28%  Similarity=0.438  Sum_probs=17.3

Q ss_pred             hhHHhcCCHHHHHHH-HHHHHHhhhh
Q 031653           32 LDALLDMSNDELVKL-FSARARRRFQ   56 (155)
Q Consensus        32 ld~L~~ms~eel~~L-~~ar~RR~~~   56 (155)
                      .|+|..++..+|-++ +|+++||-+-
T Consensus        23 w~~lf~~~s~~LK~~GIp~r~RryiL   48 (57)
T PF09597_consen   23 WEKLFTTSSKQLKELGIPVRQRRYIL   48 (57)
T ss_pred             HHHHHhcCHHHHHHCCCCHHHHHHHH
Confidence            577777777776554 4788887663


No 62 
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase. Due to the likelihood that the substrates of these enzymes are different depending on the nature of the particular polysaccharides associated with each species, this model has been classified as a subfamily despite the close homology.
Probab=24.95  E-value=57  Score=24.97  Aligned_cols=22  Identities=18%  Similarity=0.298  Sum_probs=18.9

Q ss_pred             ecCChhHHhcCCHHHHHHHHHH
Q 031653           28 RGVDLDALLDMSNDELVKLFSA   49 (155)
Q Consensus        28 RG~~ld~L~~ms~eel~~L~~a   49 (155)
                      |++-.+++.+||+||+-+|+..
T Consensus       100 ~~ir~~~~~~~~~~~~~~~~~~  121 (126)
T TIGR01689       100 RAIRPSEFSSLTYDEINTLTKI  121 (126)
T ss_pred             hhhCHHHHHhcCHHHHHHHHhh
Confidence            6677899999999999988854


No 63 
>COG0372 GltA Citrate synthase [Energy production and conversion]
Probab=24.91  E-value=58  Score=29.72  Aligned_cols=22  Identities=32%  Similarity=0.611  Sum_probs=17.1

Q ss_pred             eeeecCChhHHhcCC-HHHHHHH
Q 031653           25 FSFRGVDLDALLDMS-NDELVKL   46 (155)
Q Consensus        25 FtYRG~~ld~L~~ms-~eel~~L   46 (155)
                      -+|||++++||.+-+ .+|+.-|
T Consensus        40 L~yrGy~i~dla~~~~feev~~L   62 (390)
T COG0372          40 LRYRGYDIEDLAEKSSFEEVAYL   62 (390)
T ss_pred             EEECCccHHHHHhhcCHHHHHHH
Confidence            789999999999885 5554433


No 64 
>PF10109 FluMu_gp41:  Mu-like prophage FluMu protein gp41;  InterPro: IPR019289  Members of this family of prokaryotic proteins include various Gp41 proteins and related sequences []. 
Probab=24.26  E-value=86  Score=20.93  Aligned_cols=22  Identities=18%  Similarity=0.280  Sum_probs=17.7

Q ss_pred             ecCChhHHhcCCHHHHHHHHHH
Q 031653           28 RGVDLDALLDMSNDELVKLFSA   49 (155)
Q Consensus        28 RG~~ld~L~~ms~eel~~L~~a   49 (155)
                      -|++.++|.+|+..++.++...
T Consensus        55 ~gl~~~~l~~L~~~D~~~l~~~   76 (82)
T PF10109_consen   55 TGLPPEDLDQLDARDYNRLQEA   76 (82)
T ss_pred             cCCCHHHHHcCCHHHHHHHHHH
Confidence            3689999999999998877543


No 65 
>PF07647 SAM_2:  SAM domain (Sterile alpha motif);  InterPro: IPR011510 The sterile alpha motif (SAM) domain is a putative protein interaction module present in a wide variety of proteins [] involved in many biological processes. The SAM domain that spreads over around 70 residues is found in diverse eukaryotic organisms []. SAM domains have been shown to homo- and hetero-oligomerise, forming multiple self-association architectures and also binding to various non-SAM domain-containing proteins [], nevertheless with a low affinity constant []. SAM domains also appear to possess the ability to bind RNA []. Smaug, a protein that helps to establish a morphogen gradient in Drosophila embryos by repressing the translation of nanos (nos) mRNA, binds to the 3' untranslated region (UTR) of nos mRNA via two similar hairpin structures. The 3D crystal structure of the Smaug RNA-binding region shows a cluster of positively charged residues on the Smaug-SAM domain, which could be the RNA-binding surface. This electropositive potential is unique among all previously determined SAM-domain structures and is conserved among Smaug-SAM homologs. These results suggest that the SAM domain might have a primary role in RNA binding.  Structural analyses show that the SAM domain is arranged in a small five-helix bundle with two large interfaces []. In the case of the SAM domain of EphB2, each of these interfaces is able to form dimers. The presence of these two distinct intermonomers binding surface suggest that SAM could form extended polymeric structures []. This entry represents a second domain related to the SAM domain. ; GO: 0005515 protein binding; PDB: 1B0X_A 1X9X_B 1OW5_A 1V38_A 3BS7_A 3BS5_A 3TAD_A 3TAC_B 2K60_A 2DL0_A ....
Probab=22.66  E-value=39  Score=21.73  Aligned_cols=34  Identities=26%  Similarity=0.536  Sum_probs=24.3

Q ss_pred             ceeeeeecCCh-hHHhcCCHHHHHHH-H-HHHHHhhh
Q 031653           22 FKKFSFRGVDL-DALLDMSNDELVKL-F-SARARRRF   55 (155)
Q Consensus        22 f~kFtYRG~~l-d~L~~ms~eel~~L-~-~ar~RR~~   55 (155)
                      -..|...|++- +.|..|+.++|.++ + +...|+++
T Consensus        22 ~~~f~~~~i~g~~~L~~l~~~~L~~lGI~~~~~r~kl   58 (66)
T PF07647_consen   22 ADNFRENGIDGLEDLLQLTEEDLKELGITNLGHRRKL   58 (66)
T ss_dssp             HHHHHHTTCSHHHHHTTSCHHHHHHTTTTHHHHHHHH
T ss_pred             HHHHHHcCCcHHHHHhhCCHHHHHHcCCCCHHHHHHH
Confidence            34477789998 99999999998765 2 34444444


No 66 
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed
Probab=21.11  E-value=92  Score=31.50  Aligned_cols=28  Identities=21%  Similarity=0.542  Sum_probs=24.5

Q ss_pred             cceeeeeecCChhHHhcCCHHHHHHHHH
Q 031653           21 TFKKFSFRGVDLDALLDMSNDELVKLFS   48 (155)
Q Consensus        21 tf~kFtYRG~~ld~L~~ms~eel~~L~~   48 (155)
                      .-...+|+|.++.|+++|+.+|..+++.
T Consensus       775 e~l~v~~~g~~i~dvl~ltv~E~l~~f~  802 (943)
T PRK00349        775 ETLEVKYKGKNIADVLDMTVEEALEFFE  802 (943)
T ss_pred             cceEEEECCCCHHHHhcCcHHHHHHHHH
Confidence            3456899999999999999999888874


No 67 
>TIGR00630 uvra excinuclease ABC, A subunit. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=20.31  E-value=78  Score=31.90  Aligned_cols=27  Identities=15%  Similarity=0.249  Sum_probs=23.3

Q ss_pred             eeeeeecCChhHHhcCCHHHHHHHHHH
Q 031653           23 KKFSFRGVDLDALLDMSNDELVKLFSA   49 (155)
Q Consensus        23 ~kFtYRG~~ld~L~~ms~eel~~L~~a   49 (155)
                      ..++|.|+++.|+.+|+.+|+.+.+..
T Consensus       420 l~v~i~g~~I~e~~~~~v~~~~~~~~~  446 (924)
T TIGR00630       420 LAVKVGGKSIADVSELSIREAHEFFNQ  446 (924)
T ss_pred             heeEECCEEHHHHhcCCHHHHHHHHHh
Confidence            358899999999999999998877754


Done!