BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031657
         (155 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2A92|A Chain A, Crystal Structure Of Lactate Dehydrogenase From Plasmodium
           Vivax: Complex With Nadh
 pdb|2A92|B Chain B, Crystal Structure Of Lactate Dehydrogenase From Plasmodium
           Vivax: Complex With Nadh
 pdb|2A92|C Chain C, Crystal Structure Of Lactate Dehydrogenase From Plasmodium
           Vivax: Complex With Nadh
 pdb|2A92|D Chain D, Crystal Structure Of Lactate Dehydrogenase From Plasmodium
           Vivax: Complex With Nadh
 pdb|2AA3|A Chain A, Crystal Structure Of Plasmodium Vivax Lactate
           Dehydrogenase Complex With Apadh
 pdb|2AA3|B Chain B, Crystal Structure Of Plasmodium Vivax Lactate
           Dehydrogenase Complex With Apadh
 pdb|2AA3|C Chain C, Crystal Structure Of Plasmodium Vivax Lactate
           Dehydrogenase Complex With Apadh
 pdb|2AA3|D Chain D, Crystal Structure Of Plasmodium Vivax Lactate
           Dehydrogenase Complex With Apadh
          Length = 321

 Score = 27.7 bits (60), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 3/61 (4%)

Query: 83  MPQVKSLSIFFCEKLKSLPDQLLRSTTLESLEIADVPIVEENFKKDTG---KDWSKISHI 139
           MPQ K+L       +     ++  S + + L+ ADV IV   F K  G   K+W++   +
Sbjct: 39  MPQGKALDTSHSNVMAYSNCKVTGSNSYDDLKGADVVIVTAGFTKAPGKSDKEWNRDDLL 98

Query: 140 P 140
           P
Sbjct: 99  P 99


>pdb|3I4R|B Chain B, Nup107(Aa658-925)NUP133(AA517-1156) Complex, H.Sapiens
          Length = 644

 Score = 26.2 bits (56), Expect = 7.8,   Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 94  CEKLKSLPDQLLRSTTLESLEIADVPIVEENFKKD 128
           CE L    +Q+LR   ++S+E A+V I   N  KD
Sbjct: 188 CECLLEHEEQVLRDAPMDSIEWAEVVINVNNILKD 222


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.141    0.417 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,560,832
Number of Sequences: 62578
Number of extensions: 164485
Number of successful extensions: 314
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 312
Number of HSP's gapped (non-prelim): 5
length of query: 155
length of database: 14,973,337
effective HSP length: 91
effective length of query: 64
effective length of database: 9,278,739
effective search space: 593839296
effective search space used: 593839296
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 47 (22.7 bits)