Query         031673
Match_columns 155
No_of_seqs    120 out of 191
Neff          4.6 
Searched_HMMs 29240
Date          Mon Mar 25 05:30:13 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031673.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/031673hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 3zsu_A TLL2057 protein, cyanoq  22.7      26  0.0009   26.3   0.9   57   29-87      8-73  (130)
  2 4a3n_A Transcription factor SO  20.7      17 0.00059   22.7  -0.4   10   76-85      6-15  (71)
  3 3u2b_C Transcription factor SO  18.7      20  0.0007   23.0  -0.4   10   76-85      6-15  (79)
  4 1i11_A Transcription factor SO  17.1      24 0.00081   23.0  -0.4   10   76-85      8-17  (81)
  5 3f27_D Transcription factor SO  16.9      24 0.00082   23.0  -0.4   10   76-85     10-19  (83)
  6 2l6a_A Nacht, LRR and PYD doma  16.8 1.7E+02  0.0057   20.5   4.1   18   61-78     68-85  (102)
  7 2k1a_A Integrin alpha-IIB; sin  16.4      69  0.0024   19.5   1.7    9  140-148    27-35  (42)
  8 2lef_A LEF-1 HMG, protein (lym  16.3      25 0.00086   23.2  -0.4   10   76-85      6-15  (86)
  9 2knc_A Integrin alpha-IIB; tra  15.4      74  0.0025   20.4   1.7   10  139-148    28-37  (54)
 10 2l8s_A Integrin alpha-1; trans  15.2      75  0.0026   20.5   1.7   10  139-148    25-34  (54)

No 1  
>3zsu_A TLL2057 protein, cyanoq; photosystem II assembly, photosynthesis, extrinsic protein; 1.60A {Thermosynechococcus elongatus}
Probab=22.68  E-value=26  Score=26.29  Aligned_cols=57  Identities=14%  Similarity=0.293  Sum_probs=33.3

Q ss_pred             CCCCCCCCCCCCCCC-----cchhhhhhhhhHHHHHHHHHHHH----HhhhhhhhHHHHHHHHHHhCC
Q 031673           29 DIADPPGFSRASQDQ-----DDSTLSRQKKDAEANWKSQKAWE----VAQAPFKNLMMMGFMMWMAGS   87 (155)
Q Consensus        29 ~lp~PpGy~~~~~~~-----~~~~~~~~~~~~~~~Lk~KkaWe----iA~~P~K~ipMn~FMmyMsGn   87 (155)
                      ..+.||.|++.....     ..-.....+-.+...|..+|-|.    +-.+|+.++-.+  |.|.+.|
T Consensus         8 ~~~~pptysp~~i~~iq~y~~~i~~~r~Rl~eL~~lI~~~~W~~~Rn~IhGPlg~lr~~--m~~l~~~   73 (130)
T 3zsu_A            8 TTPPPPTYSELQITRIQDYLRDIEKNAERFADLEVSVAKGDWQEARNIMRGPLGEMLMD--MRALNRN   73 (130)
T ss_dssp             ----CCCCCHHHHHHHHHHHHHHHHHHTTHHHHHHHHHTTCHHHHHHHHHTHHHHHHHH--HHHHHHT
T ss_pred             cCCCCCCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcchHHHHHHHhchHHHHHHH--HHHHHHh
Confidence            456799999752110     00111122335678899999993    567888888877  6666554


No 2  
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0
Probab=20.70  E-value=17  Score=22.75  Aligned_cols=10  Identities=40%  Similarity=0.873  Sum_probs=8.1

Q ss_pred             HHHHHHHHHh
Q 031673           76 MMMGFMMWMA   85 (155)
Q Consensus        76 pMn~FMmyMs   85 (155)
                      |+|.||+|+.
T Consensus         6 P~~af~lf~~   15 (71)
T 4a3n_A            6 PMNAFMVWAK   15 (71)
T ss_dssp             CCCHHHHHHH
T ss_pred             CCCHHHHHHH
Confidence            7889999864


No 3  
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1
Probab=18.66  E-value=20  Score=23.00  Aligned_cols=10  Identities=40%  Similarity=0.856  Sum_probs=8.1

Q ss_pred             HHHHHHHHHh
Q 031673           76 MMMGFMMWMA   85 (155)
Q Consensus        76 pMn~FMmyMs   85 (155)
                      |+|.||+|+.
T Consensus         6 P~naf~lf~~   15 (79)
T 3u2b_C            6 PMNAFMVWSQ   15 (79)
T ss_dssp             CCCHHHHHHH
T ss_pred             CCCHHHHHHH
Confidence            7889998874


No 4  
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1
Probab=17.14  E-value=24  Score=22.99  Aligned_cols=10  Identities=40%  Similarity=0.873  Sum_probs=8.2

Q ss_pred             HHHHHHHHHh
Q 031673           76 MMMGFMMWMA   85 (155)
Q Consensus        76 pMn~FMmyMs   85 (155)
                      |+|.||+|+.
T Consensus         8 P~naf~lf~~   17 (81)
T 1i11_A            8 PMNAFMVWAK   17 (81)
T ss_dssp             SCCHHHHHHH
T ss_pred             CCCHHHHHHH
Confidence            7889998875


No 5  
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A
Probab=16.91  E-value=24  Score=22.95  Aligned_cols=10  Identities=40%  Similarity=0.873  Sum_probs=8.3

Q ss_pred             HHHHHHHHHh
Q 031673           76 MMMGFMMWMA   85 (155)
Q Consensus        76 pMn~FMmyMs   85 (155)
                      |+|.||+|+.
T Consensus        10 P~~af~lf~~   19 (83)
T 3f27_D           10 PMNAFMVWAK   19 (83)
T ss_dssp             CCCHHHHHHH
T ss_pred             CCCHHHHHHH
Confidence            7899999974


No 6  
>2l6a_A Nacht, LRR and PYD domains-containing protein 12; NLRP12, pyrin, death domain, signaling protein; NMR {Homo sapiens}
Probab=16.77  E-value=1.7e+02  Score=20.49  Aligned_cols=18  Identities=22%  Similarity=0.558  Sum_probs=14.6

Q ss_pred             HHHHHHHhhhhhhhHHHH
Q 031673           61 SQKAWEVAQAPFKNLMMM   78 (155)
Q Consensus        61 ~KkaWeiA~~P~K~ipMn   78 (155)
                      .+.||++++..+.+|..+
T Consensus        68 e~~A~~vt~~if~~mn~~   85 (102)
T 2l6a_A           68 PEEAWRLALSTFERINRK   85 (102)
T ss_dssp             HHHHHHHHHHHHGGGTCH
T ss_pred             HHHHHHHHHHHHHHcCHH
Confidence            348999999999987654


No 7  
>2k1a_A Integrin alpha-IIB; single-PASS transmembrane segment, alternative splicing, calcium, cell adhesion, cleavage on PAIR of basic residues; NMR {Homo sapiens} PDB: 2k9j_A
Probab=16.41  E-value=69  Score=19.50  Aligned_cols=9  Identities=56%  Similarity=1.110  Sum_probs=6.3

Q ss_pred             HHHHHHhhc
Q 031673          140 LALGVWKVR  148 (155)
Q Consensus       140 l~lglyK~~  148 (155)
                      +.++||||.
T Consensus        27 i~~~LwK~G   35 (42)
T 2k1a_A           27 LVLAMWKVG   35 (42)
T ss_dssp             HHHHHHHTT
T ss_pred             HHHHHHHcC
Confidence            346889984


No 8  
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1
Probab=16.33  E-value=25  Score=23.17  Aligned_cols=10  Identities=30%  Similarity=0.693  Sum_probs=8.1

Q ss_pred             HHHHHHHHHh
Q 031673           76 MMMGFMMWMA   85 (155)
Q Consensus        76 pMn~FMmyMs   85 (155)
                      |||+||+|+.
T Consensus         6 P~naf~lf~~   15 (86)
T 2lef_A            6 PLNAFMLYMK   15 (86)
T ss_dssp             CCCHHHHHHH
T ss_pred             CCCHHHHHHH
Confidence            7888888875


No 9  
>2knc_A Integrin alpha-IIB; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens}
Probab=15.35  E-value=74  Score=20.43  Aligned_cols=10  Identities=50%  Similarity=0.850  Sum_probs=6.8

Q ss_pred             HHHHHHHhhc
Q 031673          139 GLALGVWKVR  148 (155)
Q Consensus       139 ~l~lglyK~~  148 (155)
                      .+.++||||.
T Consensus        28 li~~~LwK~G   37 (54)
T 2knc_A           28 ILVLAMWKVG   37 (54)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHcC
Confidence            3446889984


No 10 
>2l8s_A Integrin alpha-1; transmembrane region, detergent micelle, CE adhesion; NMR {Homo sapiens}
Probab=15.17  E-value=75  Score=20.48  Aligned_cols=10  Identities=40%  Similarity=0.820  Sum_probs=6.8

Q ss_pred             HHHHHHHhhc
Q 031673          139 GLALGVWKVR  148 (155)
Q Consensus       139 ~l~lglyK~~  148 (155)
                      .+.++||||.
T Consensus        25 Lii~~LwK~G   34 (54)
T 2l8s_A           25 LLILALWKIG   34 (54)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHcC
Confidence            3446889984


Done!