BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031695
         (155 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2OAP|1 Chain 1, Crystal Structure Of The Archaeal Secretion Atpase Gspe In
           Complex With Amp-Pnp
 pdb|2OAP|2 Chain 2, Crystal Structure Of The Archaeal Secretion Atpase Gspe In
           Complex With Amp-Pnp
 pdb|2OAQ|1 Chain 1, Crystal Structure Of The Archaeal Secretion Atpase Gspe In
           Complex With Phosphate
 pdb|2OAQ|2 Chain 2, Crystal Structure Of The Archaeal Secretion Atpase Gspe In
           Complex With Phosphate
          Length = 511

 Score = 30.4 bits (67), Expect = 0.47,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 23/38 (60%)

Query: 111 DKKEFGQIFIKFTQVSTYELSLSFSCNFYTMVFIYLFR 148
           D +E  ++ ++  +  + E ++SF+ NFY+    YLFR
Sbjct: 90  DLEERAEVLVRAIEKLSKEYAVSFTDNFYSRXLYYLFR 127


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.330    0.144    0.439 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,947,656
Number of Sequences: 62578
Number of extensions: 125699
Number of successful extensions: 297
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 296
Number of HSP's gapped (non-prelim): 1
length of query: 155
length of database: 14,973,337
effective HSP length: 91
effective length of query: 64
effective length of database: 9,278,739
effective search space: 593839296
effective search space used: 593839296
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 47 (22.7 bits)