Citrus Sinensis ID: 031705


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----
MGVVDHFSDYFDCSHGSSKLKKRRQLQTVEVKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVVGYVEPSKVVSRIAHRTGKKAEIWPYVPYDVVAHPYAPGVYDRKAPAGYVRRADDPQVSQIARASSFEVRYTTAFSDENTQACAIM
ccccccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEEccHHHHHHHHHHHccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*GVVDHFSDYFDC**************TVEVKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVVGYVEPSKVVSRIAHRTGKKAEIWPYVPYDVVAHPYAPGVYDRKAPAGYVRRADDPQVSQIARASSFEVRYTTAFSDENTQACAIM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGVVDHFSDYFDCSHGSSKLKKRRQLQTVEVKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVVGYVEPSKVVSRIAHRTGKKAEIWPYVPYDVVAHPYAPGVYDRKAPAGYVRRADDPQVSQIARASSFEVRYTTAFSDENTQACAIM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Heavy metal-associated isoprenylated plant protein 26 Heavy-metal-binding protein. Binds lead, cadmium and copper. May be involved in heavy-metal transport.confidentQ9SZN7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CRL, chain A
Confidence level:confident
Coverage over the Query: 24-96
View the alignment between query and template
View the model in PyMOL