Citrus Sinensis ID: 031714

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150----

MGVVDHFSDYFDCSHGSSKLKKRRQLQTVEVKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVVGYVEPSKVVSRIAHRTGKKAEIWPYVPYDVVAHPYAPGVYDRKAPAGYVRRADDPQVSQIARASSFEVRYTTAFSDENTQACAIM

ccccccccccccccccccccccccccEEEEEEEEcccHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEEccHHHHHHHHHHHccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*GVVDHFSDYFDC**************TVEVKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVVGYVEPSKVVSRIAHRTGKKAEIWPYVPYDVVAHPYAPGVYDRKAPAGYVRRADDPQVSQIARASSFEVRYTTAFSDENTQACAIM

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGVVDHFSDYFDCSHGSSKLKKRRQLQTVEVKVRIDCEGCERKVKRAVEGMKGVKQVDVERKANKVTVVGYVEPSKVVSRIAHRTGKKAEIWPYVPYDVVAHPYAPGVYDRKAPAGYVRRADDPQVSQIARASSFEVRYTTAFSDENTQACAIM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Heavy metal-associated isoprenylated plant protein 26	Heavy-metal-binding protein. Binds lead, cadmium and copper. May be involved in heavy-metal transport.	confident	Q9SZN7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CRL, chain A
Confidence level:confident
Coverage over the Query: 24-96
View the alignment between query and template
View the model in PyMOL