BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031719
         (154 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3SDO|A Chain A, Structure Of A Nitrilotriacetate Monooxygenase From
           Burkholderia Pseudomallei
 pdb|3SDO|B Chain B, Structure Of A Nitrilotriacetate Monooxygenase From
           Burkholderia Pseudomallei
          Length = 453

 Score = 30.8 bits (68), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 33/78 (42%), Gaps = 3/78 (3%)

Query: 51  TLVHLSHFFVTYHFFHWKKGTPFADDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLY 110
            L +LSHFF  + F  +    PF  D G      +    DN K+L R RK    +  V Y
Sbjct: 300 ALAYLSHFFQQHDFSVYPLDGPFP-DIGTLGSDGFQSTTDNIKRLARERKL--TLREVAY 356

Query: 111 LIASHTTDYQNPMLFFNT 128
            +++  ++      F  T
Sbjct: 357 EVSTRRSNIGTSEAFIGT 374


>pdb|1D9U|A Chain A, Bacteriophage Lambda Lysozyme Complexed With A
           Chitohexasacharide
 pdb|1D9U|B Chain B, Bacteriophage Lambda Lysozyme Complexed With A
           Chitohexasacharide
 pdb|3D3D|A Chain A, Bacteriophage Lambda Lysozyme Complexed With A
           Chitohexasaccharide
 pdb|3D3D|B Chain B, Bacteriophage Lambda Lysozyme Complexed With A
           Chitohexasaccharide
          Length = 154

 Score = 28.5 bits (62), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 83  LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQN 121
           L W E  DNG+Q TRN  +  +V   L+      TDY +
Sbjct: 15  LAWSEGTDNGRQKTRNHGYDVIVGGELF------TDYSD 47


>pdb|1TXF|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core In
           Complex With Glutamate At 2.1 Angstrom Resolution
 pdb|3C31|A Chain A, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Lithium At 1.49 Angstrom Resolution
 pdb|3C31|B Chain B, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Lithium At 1.49 Angstrom Resolution
 pdb|3C32|A Chain A, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Sodium At 1.72 Angstrom Resolution
 pdb|3C32|B Chain B, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Sodium At 1.72 Angstrom Resolution
 pdb|3C33|A Chain A, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Potassium At 1.78 Angstrom Resolution
 pdb|3C33|B Chain B, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Potassium At 1.78 Angstrom Resolution
 pdb|3C34|A Chain A, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Rubidium At 1.82 Angstrom Resolution
 pdb|3C34|B Chain B, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Rubidium At 1.82 Angstrom Resolution
 pdb|3C35|A Chain A, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Cesium At 1.97 Angstrom Resolution
 pdb|3C35|B Chain B, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Cesium At 1.97 Angstrom Resolution
 pdb|3C36|A Chain A, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Ammonium Ions At 1.68 Angstrom Resolution
 pdb|3C36|B Chain B, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Ammonium Ions At 1.68 Angstrom Resolution
          Length = 258

 Score = 26.6 bits (57), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 11/66 (16%)

Query: 75  DDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQNPMLFFNTLAVFVL 134
           +D+G +NG+         K+L  +R  L V P+ +  +     D+  P   F TL + +L
Sbjct: 65  NDKGEWNGMV--------KELIDHRADLAVAPLTITYVREKVIDFSKP---FMTLGISIL 113

Query: 135 VVAKFP 140
                P
Sbjct: 114 YRKGTP 119


>pdb|2F34|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           With Ubp310 At 1.74 Angstroms Resolution
 pdb|2F34|B Chain B, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           With Ubp310 At 1.74 Angstroms Resolution
 pdb|2F35|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core With
           Ubp302 At 1.87 Angstroms Resolution
 pdb|2F35|B Chain B, Crystal Structure Of The Glur5 Ligand Binding Core With
           Ubp302 At 1.87 Angstroms Resolution
 pdb|2F36|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           With Glutamate At 2.1 Angstroms Resolution
 pdb|2F36|B Chain B, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           With Glutamate At 2.1 Angstroms Resolution
 pdb|2F36|C Chain C, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           With Glutamate At 2.1 Angstroms Resolution
 pdb|2F36|D Chain D, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           With Glutamate At 2.1 Angstroms Resolution
 pdb|2OJT|A Chain A, Structure And Mechanism Of Kainate Receptor Modulation By
           Anions
 pdb|2OJT|B Chain B, Structure And Mechanism Of Kainate Receptor Modulation By
           Anions
 pdb|2QS1|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ubp315 At 1.80 Angstroms Resolution
 pdb|2QS1|B Chain B, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ubp315 At 1.80 Angstroms Resolution
 pdb|2QS2|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ubp318 At 1.80 Angstroms Resolution
 pdb|2QS2|B Chain B, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ubp318 At 1.80 Angstroms Resolution
 pdb|2QS3|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ubp316 At 1.76 Angstroms Resolution
 pdb|2QS3|B Chain B, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ubp316 At 1.76 Angstroms Resolution
 pdb|2QS4|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ly466195 At 1.58 Angstroms Resolution
 pdb|2QS4|B Chain B, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ly466195 At 1.58 Angstroms Resolution
 pdb|2QS4|C Chain C, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ly466195 At 1.58 Angstroms Resolution
 pdb|2QS4|D Chain D, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ly466195 At 1.58 Angstroms Resolution
          Length = 258

 Score = 26.6 bits (57), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 11/66 (16%)

Query: 75  DDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQNPMLFFNTLAVFVL 134
           +D+G +NG+         K+L  +R  L V P+ +  +     D+  P   F TL + +L
Sbjct: 65  NDKGEWNGMV--------KELIDHRADLAVAPLTITYVREKVIDFSKP---FMTLGISIL 113

Query: 135 VVAKFP 140
                P
Sbjct: 114 YRKGTP 119


>pdb|2WKY|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Glur5 In
           Complex With The Agonist 4-Ahcp
 pdb|2WKY|B Chain B, Crystal Structure Of The Ligand-Binding Core Of Glur5 In
           Complex With The Agonist 4-Ahcp
          Length = 258

 Score = 26.6 bits (57), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 11/66 (16%)

Query: 75  DDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQNPMLFFNTLAVFVL 134
           +D+G +NG+         K+L  +R  L V P+ +  +     D+  P   F TL + +L
Sbjct: 65  NDKGEWNGMV--------KELIDHRADLAVAPLTITYVREKVIDFSKP---FMTLGISIL 113

Query: 135 VVAKFP 140
                P
Sbjct: 114 YRKGTP 119


>pdb|1YCJ|A Chain A, Crystal Structure Of The Kainate Receptor Glur5 Ligand-
           Binding Core In Complex With (S)-Glutamate
 pdb|1YCJ|B Chain B, Crystal Structure Of The Kainate Receptor Glur5 Ligand-
           Binding Core In Complex With (S)-Glutamate
 pdb|1VSO|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Iglur5 In
           Complex With The Antagonist (S)-Atpo At 1.85 A
           Resolution
 pdb|2PBW|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Iglur5 In
           Complex With The Partial Agonist Domoic Acid At 2.5 A
           Resolution
 pdb|2PBW|B Chain B, Crystal Structure Of The Ligand-Binding Core Of Iglur5 In
           Complex With The Partial Agonist Domoic Acid At 2.5 A
           Resolution
 pdb|3GBA|A Chain A, X-Ray Structure Of Iglur5 Ligand-Binding Core (S1s2) In
           Complex With Dysiherbaine At 1.35a Resolution
 pdb|3GBA|B Chain B, X-Ray Structure Of Iglur5 Ligand-Binding Core (S1s2) In
           Complex With Dysiherbaine At 1.35a Resolution
 pdb|3GBA|C Chain C, X-Ray Structure Of Iglur5 Ligand-Binding Core (S1s2) In
           Complex With Dysiherbaine At 1.35a Resolution
 pdb|3GBA|D Chain D, X-Ray Structure Of Iglur5 Ligand-Binding Core (S1s2) In
           Complex With Dysiherbaine At 1.35a Resolution
 pdb|3GBB|A Chain A, X-Ray Strucutre Of Iglur5 Ligand-Binding Core (S1s2) In
           Complex With Msviii-19 At 2.10a Resolution
 pdb|3GBB|B Chain B, X-Ray Strucutre Of Iglur5 Ligand-Binding Core (S1s2) In
           Complex With Msviii-19 At 2.10a Resolution
 pdb|3S2V|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Gluk1 In
           Complex With An Antagonist
           (S)-1-(2'-Amino-2'-Carboxyethyl)-3-[(2-
           Carboxythien-3-Yl)methyl]thieno[3,4-D]pyrimidin-2,
           4-Dione At 2.5 A Resolution
 pdb|3S2V|B Chain B, Crystal Structure Of The Ligand Binding Domain Of Gluk1 In
           Complex With An Antagonist
           (S)-1-(2'-Amino-2'-Carboxyethyl)-3-[(2-
           Carboxythien-3-Yl)methyl]thieno[3,4-D]pyrimidin-2,
           4-Dione At 2.5 A Resolution
 pdb|4E0X|A Chain A, Crystal Structure Of The Kainate Receptor Gluk1
           Ligand-Binding Domain In Complex With Kainate In The
           Absence Of Glycerol
 pdb|4E0X|B Chain B, Crystal Structure Of The Kainate Receptor Gluk1
           Ligand-Binding Domain In Complex With Kainate In The
           Absence Of Glycerol
 pdb|4DLD|A Chain A, Crystal Structure Of The Gluk1 Ligand-Binding Domain
           (S1s2) In Complex With The Antagonist
           (S)-2-Amino-3-(2-(2-Carboxyethyl)-5-Chloro-4-
           Nitrophenyl)propionic Acid At 2.0 A Resolution
 pdb|4DLD|B Chain B, Crystal Structure Of The Gluk1 Ligand-Binding Domain
           (S1s2) In Complex With The Antagonist
           (S)-2-Amino-3-(2-(2-Carboxyethyl)-5-Chloro-4-
           Nitrophenyl)propionic Acid At 2.0 A Resolution
          Length = 257

 Score = 26.2 bits (56), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 11/66 (16%)

Query: 75  DDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQNPMLFFNTLAVFVL 134
           +D+G +NG+         K+L  +R  L V P+ +  +     D+  P   F TL + +L
Sbjct: 65  NDKGEWNGMV--------KELIDHRADLAVAPLTITYVREKVIDFSKP---FMTLGISIL 113

Query: 135 VVAKFP 140
                P
Sbjct: 114 YRKGTP 119


>pdb|2ZNS|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human
           Ionotropic Glutamate Receptor, Glur5, In Complex With
           Glutamate
 pdb|2ZNT|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human
           Ionotropic Glutamate Receptor, Glur5, In Complex With A
           Novel Selective Agonist, Dysiherbaine
 pdb|2ZNU|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human
           Ionotropic Glutamate Receptor, Glur5, In Complex With A
           Novel Selective Agonist, Neodysiherbaine A
 pdb|3FUZ|A Chain A, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With L-Glutamate In
           Space Group P1
 pdb|3FUZ|B Chain B, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With L-Glutamate In
           Space Group P1
 pdb|3FV1|A Chain A, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With Dysiherbaine In
           Space Group P1
 pdb|3FV1|B Chain B, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With Dysiherbaine In
           Space Group P1
 pdb|3FV2|A Chain A, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With Neodysiherbaine A
           In Space Group P1
 pdb|3FV2|B Chain B, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With Neodysiherbaine A
           In Space Group P1
 pdb|3FVG|A Chain A, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With Msviii-19 In Space
           Group P1
 pdb|3FVG|B Chain B, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With Msviii-19 In Space
           Group P1
 pdb|3FVK|A Chain A, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With
           8-Deoxy-Neodysiherbaine A In Space Group P1
 pdb|3FVK|B Chain B, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With
           8-Deoxy-Neodysiherbaine A In Space Group P1
 pdb|3FVN|A Chain A, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With
           9-Deoxy-Neodysiherbaine A In Space Group P1
 pdb|3FVN|B Chain B, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With
           9-Deoxy-Neodysiherbaine A In Space Group P1
 pdb|3FVO|A Chain A, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand-Binding Core In Complex With
           8-Epi-Neodysiherbaine A In Space Group P1
 pdb|3FVO|B Chain B, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand-Binding Core In Complex With
           8-Epi-Neodysiherbaine A In Space Group P1
          Length = 256

 Score = 26.2 bits (56), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 11/66 (16%)

Query: 75  DDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQNPMLFFNTLAVFVL 134
           +D+G +NG+         K+L  +R  L V P+ +  +     D+  P   F TL + +L
Sbjct: 64  NDKGEWNGMV--------KELIDHRADLAVAPLTITYVREKVIDFSKP---FMTLGISIL 112

Query: 135 VVAKFP 140
                P
Sbjct: 113 YRKGTP 118


>pdb|3C8G|A Chain A, Crystal Structure Of A Possible Transciptional Regulator
           Yggd From Shigella Flexneri 2a Str. 2457t
 pdb|3C8G|C Chain C, Crystal Structure Of A Possible Transciptional Regulator
           Yggd From Shigella Flexneri 2a Str. 2457t
          Length = 172

 Score = 25.8 bits (55), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 8/50 (16%)

Query: 50  WTLVHLSHFFVTYHFFHWKKGTP-FADDQGIYNGLTWWEQIDNGKQLTRN 98
           W    ++HF   +H+ + +  TP FADD         W+ I N   +TRN
Sbjct: 86  WLYADITHFSQYWHYLNEQDETPGFADD-------ITWDFISNVNSITRN 128


>pdb|3C8G|B Chain B, Crystal Structure Of A Possible Transciptional Regulator
           Yggd From Shigella Flexneri 2a Str. 2457t
          Length = 172

 Score = 25.8 bits (55), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 8/50 (16%)

Query: 50  WTLVHLSHFFVTYHFFHWKKGTP-FADDQGIYNGLTWWEQIDNGKQLTRN 98
           W    ++HF   +H+ + +  TP FADD         W+ I N   +TRN
Sbjct: 86  WLYADITHFSQYWHYLNEQDETPGFADD-------ITWDFISNVNSITRN 128


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.329    0.141    0.481 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,115,967
Number of Sequences: 62578
Number of extensions: 207972
Number of successful extensions: 492
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 491
Number of HSP's gapped (non-prelim): 10
length of query: 154
length of database: 14,973,337
effective HSP length: 90
effective length of query: 64
effective length of database: 9,341,317
effective search space: 597844288
effective search space used: 597844288
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 47 (22.7 bits)