BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031723
         (154 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1PNU|Q Chain Q, Crystal Structure Of A Streptomycin Dependent Ribosome
          From Escherichia Coli, 50s Subunit Of 70s Ribosome.
          This File, 1pnu, Contains Only Molecules Of The 50s
          Ribosomal Subunit. The 30s Subunit, Mrna, P-Site Trna,
          And A-Site Trna Are In The Pdb File 1pns.
 pdb|1PNY|Q Chain Q, Crystal Structure Of The Wild Type Ribosome From E.
          Coli, 50s Subunit Of 70s Ribosome. This File, 1pny,
          Contains Only Molecules Of The 50s Ribosomal Subunit.
          The 30s Subunit Is In The Pdb File 1pnx.
 pdb|1VOR|T Chain T, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 pdb|1VOU|T Chain T, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 pdb|1VOW|T Chain T, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 pdb|1VOY|T Chain T, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400.
 pdb|1VP0|T Chain T, Crystal Structure Of Five 70s Ribosomes From Escherichia
          Coli In Complex With Protein Y. This File Contains The
          50s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Five 70s Ribosomes And Is Described
          In Remark 400
          Length = 130

 Score = 25.8 bits (55), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 3/40 (7%)

Query: 5  KRPIHAVSTWVRRQPPKVKAFLAVVSGMA---ALVLLRFI 41
          ++P  AV+ +VR  P KV+  + V+ G +   A  LLRFI
Sbjct: 17 RKPGFAVAKYVRMSPRKVRLVVDVIRGKSVQDAEDLLRFI 56


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.333    0.142    0.434 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,615,180
Number of Sequences: 62578
Number of extensions: 106775
Number of successful extensions: 504
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 504
Number of HSP's gapped (non-prelim): 2
length of query: 154
length of database: 14,973,337
effective HSP length: 90
effective length of query: 64
effective length of database: 9,341,317
effective search space: 597844288
effective search space used: 597844288
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 47 (22.7 bits)