BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031732
         (154 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2D6F|C Chain C, Crystal Structure Of Glu-Trna(Gln) Amidotransferase In The
           Complex With Trna(Gln)
 pdb|2D6F|D Chain D, Crystal Structure Of Glu-Trna(Gln) Amidotransferase In The
           Complex With Trna(Gln)
          Length = 619

 Score = 28.1 bits (61), Expect = 2.1,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 84  YMNPQSASSKIWYVPRKKNIFRQQDDILTAAEKYMQEHGTESFERLI 130
           Y+ P   SS++ Y+     +FR +DD+L    + + E  +E  ER++
Sbjct: 410 YLRPLPTSSRM-YLETDIPLFRIEDDLLEGIRRNLPELPSEKKERIM 455


>pdb|3NXK|A Chain A, Crystal Structure Of Probable Cytoplasmic L-Asparaginase
           From Campylobacter Jejuni
 pdb|3NXK|B Chain B, Crystal Structure Of Probable Cytoplasmic L-Asparaginase
           From Campylobacter Jejuni
 pdb|3NXK|C Chain C, Crystal Structure Of Probable Cytoplasmic L-Asparaginase
           From Campylobacter Jejuni
 pdb|3NXK|D Chain D, Crystal Structure Of Probable Cytoplasmic L-Asparaginase
           From Campylobacter Jejuni
 pdb|3NXK|E Chain E, Crystal Structure Of Probable Cytoplasmic L-Asparaginase
           From Campylobacter Jejuni
 pdb|3NXK|F Chain F, Crystal Structure Of Probable Cytoplasmic L-Asparaginase
           From Campylobacter Jejuni
 pdb|3NXK|G Chain G, Crystal Structure Of Probable Cytoplasmic L-Asparaginase
           From Campylobacter Jejuni
 pdb|3NXK|H Chain H, Crystal Structure Of Probable Cytoplasmic L-Asparaginase
           From Campylobacter Jejuni
          Length = 334

 Score = 26.6 bits (57), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 13/58 (22%), Positives = 26/58 (44%)

Query: 69  FNGAAYVYRHFVRPFYMNPQSASSKIWYVPRKKNIFRQQDDILTAAEKYMQEHGTESF 126
            +G  + Y + ++    N     SK+  +P+   ++   +D    A K + EHGT+  
Sbjct: 192 VDGKVFFYNNVIKAHTKNAPFDVSKLTSLPKVDILYSYSNDGSGVAAKALFEHGTKGI 249


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.136    0.429 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,317,599
Number of Sequences: 62578
Number of extensions: 148631
Number of successful extensions: 318
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 317
Number of HSP's gapped (non-prelim): 2
length of query: 154
length of database: 14,973,337
effective HSP length: 90
effective length of query: 64
effective length of database: 9,341,317
effective search space: 597844288
effective search space used: 597844288
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 47 (22.7 bits)