Citrus Sinensis ID: 031734
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 153 | ||||||
| 356567828 | 284 | PREDICTED: uncharacterized oxidoreductas | 0.810 | 0.436 | 0.782 | 1e-55 | |
| 225438615 | 277 | PREDICTED: uncharacterized oxidoreductas | 0.816 | 0.451 | 0.8 | 3e-53 | |
| 356540058 | 286 | PREDICTED: uncharacterized oxidoreductas | 0.816 | 0.437 | 0.76 | 4e-53 | |
| 296082471 | 234 | unnamed protein product [Vitis vinifera] | 0.816 | 0.534 | 0.8 | 6e-53 | |
| 357463465 | 284 | Dehydrogenase/reductase SDR family prote | 0.823 | 0.443 | 0.753 | 1e-52 | |
| 357463463 | 298 | Retinol dehydrogenase [Medicago truncatu | 0.810 | 0.416 | 0.725 | 2e-50 | |
| 388498916 | 287 | unknown [Lotus japonicus] | 0.816 | 0.435 | 0.728 | 2e-50 | |
| 224096235 | 277 | predicted protein [Populus trichocarpa] | 0.816 | 0.451 | 0.736 | 2e-50 | |
| 224083765 | 291 | predicted protein [Populus trichocarpa] | 0.810 | 0.426 | 0.733 | 1e-45 | |
| 72255607 | 280 | 117M18_6 [Brassica rapa] | 0.803 | 0.439 | 0.674 | 3e-45 |
| >gi|356567828|ref|XP_003552117.1| PREDICTED: uncharacterized oxidoreductase C23D3.11-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 221 bits (562), Expect = 1e-55, Method: Compositional matrix adjust.
Identities = 97/124 (78%), Positives = 115/124 (92%)
Query: 29 ASKAALHSLTDTLRLELGHFGINVINVVPGAVKSNIGKSAIASYNRMPEWKLYKPFEAVI 88
ASKAALH+LTDTLRLELGHFGI+V+N+VPGA+KSNIG SAIASYNRMPEWKL+KPFEA I
Sbjct: 160 ASKAALHALTDTLRLELGHFGIDVVNIVPGAIKSNIGDSAIASYNRMPEWKLFKPFEAAI 219
Query: 89 RERAYFSQTTKSTPTEVFAKNTVATVLKNNPPAWFSFGHYSTIMAIMYHLPLSVKDFIMK 148
R+RAYFSQ +K+TPT+ FA +TVA VLK PPAWF++GHYST+MAIMYHLP+SV+DF++K
Sbjct: 220 RDRAYFSQKSKTTPTDEFAISTVAAVLKEKPPAWFTYGHYSTVMAIMYHLPISVRDFVLK 279
Query: 149 KTMK 152
K MK
Sbjct: 280 KAMK 283
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225438615|ref|XP_002281012.1| PREDICTED: uncharacterized oxidoreductase C23D3.11 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356540058|ref|XP_003538508.1| PREDICTED: uncharacterized oxidoreductase C23D3.11-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|296082471|emb|CBI21476.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357463465|ref|XP_003602014.1| Dehydrogenase/reductase SDR family protein 7-like protein [Medicago truncatula] gi|355491062|gb|AES72265.1| Dehydrogenase/reductase SDR family protein 7-like protein [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|357463463|ref|XP_003602013.1| Retinol dehydrogenase [Medicago truncatula] gi|355491061|gb|AES72264.1| Retinol dehydrogenase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388498916|gb|AFK37524.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|224096235|ref|XP_002310586.1| predicted protein [Populus trichocarpa] gi|222853489|gb|EEE91036.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224083765|ref|XP_002307115.1| predicted protein [Populus trichocarpa] gi|222856564|gb|EEE94111.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|72255607|gb|AAZ66925.1| 117M18_6 [Brassica rapa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 153 | ||||||
| TAIR|locus:2184098 | 279 | AT5G10050 [Arabidopsis thalian | 0.803 | 0.440 | 0.642 | 5.9e-41 | |
| TAIR|locus:505006716 | 285 | AT5G65205 [Arabidopsis thalian | 0.810 | 0.435 | 0.648 | 5.3e-40 | |
| UNIPROTKB|G4N286 | 284 | MGG_12983 "Uncharacterized pro | 0.797 | 0.429 | 0.304 | 5e-13 | |
| ASPGD|ASPL0000066053 | 297 | AN10875 [Emericella nidulans ( | 0.575 | 0.296 | 0.404 | 1.2e-09 | |
| CGD|CAL0006073 | 293 | AYR1 [Candida albicans (taxid: | 0.509 | 0.266 | 0.4 | 1.6e-08 | |
| ASPGD|ASPL0000035690 | 279 | AN3276 [Emericella nidulans (t | 0.745 | 0.408 | 0.357 | 2.3e-08 | |
| DICTYBASE|DDB_G0289259 | 292 | DDB_G0289259 "short-chain dehy | 0.777 | 0.407 | 0.290 | 3.3e-08 | |
| ASPGD|ASPL0000062932 | 359 | AN0216 [Emericella nidulans (t | 0.411 | 0.175 | 0.453 | 8.7e-08 | |
| ASPGD|ASPL0000034065 | 285 | AN10399 [Emericella nidulans ( | 0.614 | 0.329 | 0.340 | 1.1e-07 | |
| SGD|S000001386 | 297 | AYR1 "NADPH-dependent 1-acyl d | 0.777 | 0.400 | 0.283 | 4.4e-07 |
| TAIR|locus:2184098 AT5G10050 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 435 (158.2 bits), Expect = 5.9e-41, P = 5.9e-41
Identities = 79/123 (64%), Positives = 100/123 (81%)
Query: 29 ASKAALHSLTDTLRLELGHFGINVINVVPGAVKSNIGKSAIASYNRMPEWKLYKPFEAVI 88
A+KAA+H+LTDTLRLEL FGI+VINVVPG +++NI SA+A++N+MPE KLYKP+E I
Sbjct: 154 ATKAAIHALTDTLRLELRPFGIDVINVVPGGIRTNIANSAVATFNKMPELKLYKPYEEAI 213
Query: 89 RERAYFSQTTKSTPTEVFAKNTVATVLKNNPPAWFSFGHYSTIMAIMYHLPLSVKDFIMK 148
RERA+ SQ TP E FA++TVA VLK NPPAWFS G YST+MA+MYH+PL +KDF K
Sbjct: 214 RERAFISQRMNPTPAETFARDTVAAVLKKNPPAWFSSGRYSTLMAVMYHMPLWLKDFFQK 273
Query: 149 KTM 151
+ +
Sbjct: 274 QVL 276
|
|
| TAIR|locus:505006716 AT5G65205 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4N286 MGG_12983 "Uncharacterized protein" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000066053 AN10875 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0006073 AYR1 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000035690 AN3276 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0289259 DDB_G0289259 "short-chain dehydrogenase/reductase (SDR) family protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000062932 AN0216 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000034065 AN10399 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| SGD|S000001386 AYR1 "NADPH-dependent 1-acyl dihydroxyacetone phosphate reductase" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 153 | |||
| PRK05693 | 274 | PRK05693, PRK05693, short chain dehydrogenase; Pro | 3e-23 | |
| cd05374 | 248 | cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster | 2e-21 | |
| PRK06182 | 273 | PRK06182, PRK06182, short chain dehydrogenase; Val | 1e-08 | |
| cd05233 | 234 | cd05233, SDR_c, classical (c) SDRs | 4e-08 | |
| COG1028 | 251 | COG1028, FabG, Dehydrogenases with different speci | 1e-07 | |
| cd05332 | 257 | cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste | 2e-07 | |
| COG0300 | 265 | COG0300, DltE, Short-chain dehydrogenases of vario | 5e-07 | |
| PRK06181 | 263 | PRK06181, PRK06181, short chain dehydrogenase; Pro | 6e-07 | |
| PRK12825 | 249 | PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) | 9e-07 | |
| PRK08264 | 238 | PRK08264, PRK08264, short chain dehydrogenase; Val | 3e-06 | |
| cd09805 | 281 | cd09805, type2_17beta_HSD-like_SDR_c, human 17beta | 6e-06 | |
| PRK05993 | 277 | PRK05993, PRK05993, short chain dehydrogenase; Pro | 6e-06 | |
| cd05370 | 228 | cd05370, SDR_c2, classical (c) SDR, subgroup 2 | 7e-06 | |
| COG3967 | 245 | COG3967, DltE, Short-chain dehydrogenase involved | 8e-06 | |
| PRK06484 | 520 | PRK06484, PRK06484, short chain dehydrogenase; Val | 1e-05 | |
| PRK05855 | 582 | PRK05855, PRK05855, short chain dehydrogenase; Val | 2e-05 | |
| cd05358 | 253 | cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (Glc | 4e-05 | |
| PRK06914 | 280 | PRK06914, PRK06914, short chain dehydrogenase; Pro | 5e-05 | |
| PRK05653 | 246 | PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) | 5e-05 | |
| PRK08220 | 252 | PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehy | 6e-05 | |
| PRK05557 | 248 | PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) | 7e-05 | |
| TIGR04316 | 250 | TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxyben | 2e-04 | |
| PRK05650 | 270 | PRK05650, PRK05650, short chain dehydrogenase; Pro | 3e-04 | |
| cd08932 | 223 | cd08932, HetN_like_SDR_c, HetN oxidoreductase-like | 5e-04 | |
| COG4221 | 246 | COG4221, COG4221, Short-chain alcohol dehydrogenas | 5e-04 | |
| PRK12827 | 249 | PRK12827, PRK12827, short chain dehydrogenase; Pro | 6e-04 | |
| cd05346 | 249 | cd05346, SDR_c5, classical (c) SDR, subgroup 5 | 6e-04 | |
| cd05354 | 235 | cd05354, SDR_c7, classical (c) SDR, subgroup 7 | 8e-04 | |
| PRK07024 | 257 | PRK07024, PRK07024, short chain dehydrogenase; Pro | 8e-04 | |
| PRK06841 | 255 | PRK06841, PRK06841, short chain dehydrogenase; Pro | 0.001 | |
| cd05369 | 249 | cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reducta | 0.001 | |
| PRK07231 | 251 | PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) | 0.001 | |
| cd05359 | 242 | cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_c | 0.001 | |
| cd05325 | 233 | cd05325, carb_red_sniffer_like_SDR_c, carbonyl red | 0.001 | |
| PRK06171 | 266 | PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydro | 0.001 | |
| cd08939 | 239 | cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine | 0.002 | |
| PRK12743 | 256 | PRK12743, PRK12743, oxidoreductase; Provisional | 0.002 | |
| PRK12748 | 256 | PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-prote | 0.002 | |
| PRK05565 | 247 | PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) | 0.002 | |
| PRK08017 | 256 | PRK08017, PRK08017, oxidoreductase; Provisional | 0.002 | |
| PRK08063 | 250 | PRK08063, PRK08063, enoyl-(acyl carrier protein) r | 0.002 | |
| PRK12826 | 251 | PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote | 0.003 | |
| PRK08251 | 248 | PRK08251, PRK08251, short chain dehydrogenase; Pro | 0.003 | |
| PRK08177 | 225 | PRK08177, PRK08177, short chain dehydrogenase; Pro | 0.003 | |
| PRK07074 | 257 | PRK07074, PRK07074, short chain dehydrogenase; Pro | 0.003 | |
| PRK12829 | 264 | PRK12829, PRK12829, short chain dehydrogenase; Pro | 0.004 | |
| cd05333 | 240 | cd05333, BKR_SDR_c, beta-Keto acyl carrier protein | 0.004 | |
| PRK07060 | 245 | PRK07060, PRK07060, short chain dehydrogenase; Pro | 0.004 | |
| cd05331 | 244 | cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydroz | 0.004 | |
| cd08944 | 246 | cd08944, SDR_c12, classical (c) SDR, subgroup 12 | 0.004 | |
| cd05356 | 239 | cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxyst | 0.004 |
| >gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
Score = 91.8 bits (228), Expect = 3e-23
Identities = 42/123 (34%), Positives = 65/123 (52%), Gaps = 3/123 (2%)
Query: 29 ASKAALHSLTDTLRLELGHFGINVINVVPGAVKSNIGKSAIASYNRM-PEWKLYKPFEAV 87
ASKAA+H+L+D LRLEL FG+ V+ V PGA+ S +A ++ E + P
Sbjct: 145 ASKAAVHALSDALRLELAPFGVQVMEVQPGAIASQFASNASREAEQLLAEQSPWWPLREH 204
Query: 88 IRERAYFSQTTKSTPTEVFAKNTVATVLKNNPPAWFSFGHYSTIMAIMYH-LPLSVKDFI 146
I+ RA SQ TP FA+ +A V ++ P G+ S + ++ LP + D +
Sbjct: 205 IQARARASQ-DNPTPAAEFARQLLAAVQQSPRPRLVRLGNGSRALPLLARLLPRGLLDRV 263
Query: 147 MKK 149
++K
Sbjct: 264 LRK 266
|
Length = 274 |
| >gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|187665 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta-hydroxysteroid dehydrogenase type 2 (type 2 17beta-HSD)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|180343 PRK05993, PRK05993, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 | Back alignment and domain information |
|---|
| >gnl|CDD|226476 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235628 PRK05855, PRK05855, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|187616 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236190 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|213929 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187604 cd05346, SDR_c5, classical (c) SDR, subgroup 5 | Back alignment and domain information |
|---|
| >gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 | Back alignment and domain information |
|---|
| >gnl|CDD|235910 PRK07024, PRK07024, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187627 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187617 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_coenzyme A_reductase (ChcA)_like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|237187 PRK12743, PRK12743, oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237189 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181198 PRK08017, PRK08017, oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236145 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|181324 PRK08251, PRK08251, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236173 PRK08177, PRK08177, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187592 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 | Back alignment and domain information |
|---|
| >gnl|CDD|187614 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxysteroid dehydrogenases (17beta-HSDs) types -1, -3, and -12, -like, classical (c) SDRs | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 153 | |||
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 99.93 | |
| KOG1610 | 322 | consensus Corticosteroid 11-beta-dehydrogenase and | 99.92 | |
| KOG1200 | 256 | consensus Mitochondrial/plastidial beta-ketoacyl-A | 99.88 | |
| KOG1201 | 300 | consensus Hydroxysteroid 17-beta dehydrogenase 11 | 99.88 | |
| KOG1209 | 289 | consensus 1-Acyl dihydroxyacetone phosphate reduct | 99.87 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 99.87 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 99.86 | |
| COG4221 | 246 | Short-chain alcohol dehydrogenase of unknown speci | 99.85 | |
| PRK05599 | 246 | hypothetical protein; Provisional | 99.83 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 99.83 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 99.83 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 99.81 | |
| PRK07904 | 253 | short chain dehydrogenase; Provisional | 99.8 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 99.8 | |
| PF13561 | 241 | adh_short_C2: Enoyl-(Acyl carrier protein) reducta | 99.8 | |
| PRK08690 | 261 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.8 | |
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.8 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.8 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 99.8 | |
| PRK08340 | 259 | glucose-1-dehydrogenase; Provisional | 99.79 | |
| PRK06603 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.79 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 99.79 | |
| KOG1205 | 282 | consensus Predicted dehydrogenase [Secondary metab | 99.79 | |
| PRK07984 | 262 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.78 | |
| PRK08594 | 257 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.78 | |
| PRK06997 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.78 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 99.78 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 99.77 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 99.77 | |
| PRK08415 | 274 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.77 | |
| PRK07370 | 258 | enoyl-(acyl carrier protein) reductase; Validated | 99.77 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 99.77 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 99.76 | |
| PRK07533 | 258 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.76 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 99.76 | |
| PRK08159 | 272 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.76 | |
| PRK05650 | 270 | short chain dehydrogenase; Provisional | 99.75 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 99.75 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 99.74 | |
| PLN02730 | 303 | enoyl-[acyl-carrier-protein] reductase | 99.74 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 99.74 | |
| KOG0725 | 270 | consensus Reductases with broad range of substrate | 99.73 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 99.73 | |
| KOG1014 | 312 | consensus 17 beta-hydroxysteroid dehydrogenase typ | 99.73 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 99.72 | |
| PRK06101 | 240 | short chain dehydrogenase; Provisional | 99.72 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 99.72 | |
| KOG1207 | 245 | consensus Diacetyl reductase/L-xylulose reductase | 99.72 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 99.72 | |
| PRK06300 | 299 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.71 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 99.71 | |
| PRK07102 | 243 | short chain dehydrogenase; Provisional | 99.71 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 99.71 | |
| PRK12747 | 252 | short chain dehydrogenase; Provisional | 99.7 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 99.7 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 99.7 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 99.7 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 99.7 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 99.7 | |
| PRK07832 | 272 | short chain dehydrogenase; Provisional | 99.7 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 99.69 | |
| PRK12859 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 99.69 | |
| KOG4169 | 261 | consensus 15-hydroxyprostaglandin dehydrogenase an | 99.69 | |
| PRK07889 | 256 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.69 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 99.69 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 99.69 | |
| TIGR01500 | 256 | sepiapter_red sepiapterin reductase. This model de | 99.69 | |
| PRK06940 | 275 | short chain dehydrogenase; Provisional | 99.68 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 99.68 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 99.68 | |
| PRK06398 | 258 | aldose dehydrogenase; Validated | 99.68 | |
| PRK06463 | 255 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.68 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 99.68 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 99.67 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 99.67 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 99.67 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 99.67 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 99.67 | |
| TIGR01831 | 239 | fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas | 99.66 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 99.66 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 99.66 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 99.66 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 99.65 | |
| PRK07791 | 286 | short chain dehydrogenase; Provisional | 99.65 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 99.65 | |
| PRK12428 | 241 | 3-alpha-hydroxysteroid dehydrogenase; Provisional | 99.65 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 99.65 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 99.65 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 99.64 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.64 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 99.63 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 99.63 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 99.63 | |
| PRK05884 | 223 | short chain dehydrogenase; Provisional | 99.63 | |
| PRK06550 | 235 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.62 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 99.62 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 99.62 | |
| PRK08643 | 256 | acetoin reductase; Validated | 99.62 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 99.62 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 99.62 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 99.61 | |
| PRK08017 | 256 | oxidoreductase; Provisional | 99.61 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 99.6 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 99.6 | |
| PRK12743 | 256 | oxidoreductase; Provisional | 99.6 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 99.6 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 99.59 | |
| PRK07578 | 199 | short chain dehydrogenase; Provisional | 99.58 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 99.58 | |
| PRK07677 | 252 | short chain dehydrogenase; Provisional | 99.58 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 99.58 | |
| PRK12938 | 246 | acetyacetyl-CoA reductase; Provisional | 99.57 | |
| PRK06483 | 236 | dihydromonapterin reductase; Provisional | 99.56 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 99.56 | |
| TIGR02685 | 267 | pter_reduc_Leis pteridine reductase. Pteridine red | 99.56 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 99.55 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 99.54 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 99.54 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 99.54 | |
| PRK08063 | 250 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.54 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 99.53 | |
| TIGR02415 | 254 | 23BDH acetoin reductases. One member of this famil | 99.53 | |
| PRK09009 | 235 | C factor cell-cell signaling protein; Provisional | 99.53 | |
| PRK07069 | 251 | short chain dehydrogenase; Validated | 99.53 | |
| PRK12748 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 99.52 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 99.52 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 99.52 | |
| KOG1210 | 331 | consensus Predicted 3-ketosphinganine reductase [S | 99.51 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 99.51 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 99.51 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 99.51 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 99.5 | |
| PRK12824 | 245 | acetoacetyl-CoA reductase; Provisional | 99.5 | |
| PRK06947 | 248 | glucose-1-dehydrogenase; Provisional | 99.49 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 99.49 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 99.49 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.49 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 99.48 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 99.48 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 99.48 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.48 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 99.47 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 99.47 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 99.47 | |
| KOG1204 | 253 | consensus Predicted dehydrogenase [Secondary metab | 99.47 | |
| TIGR01829 | 242 | AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy | 99.47 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 99.46 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 99.46 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 99.46 | |
| PRK12935 | 247 | acetoacetyl-CoA reductase; Provisional | 99.46 | |
| PRK07023 | 243 | short chain dehydrogenase; Provisional | 99.46 | |
| PRK06123 | 248 | short chain dehydrogenase; Provisional | 99.45 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 99.45 | |
| KOG1611 | 249 | consensus Predicted short chain-type dehydrogenase | 99.45 | |
| PRK06924 | 251 | short chain dehydrogenase; Provisional | 99.45 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 99.44 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 99.44 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.44 | |
| COG3967 | 245 | DltE Short-chain dehydrogenase involved in D-alani | 99.43 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 99.43 | |
| PRK10538 | 248 | malonic semialdehyde reductase; Provisional | 99.43 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.43 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 99.43 | |
| PRK05717 | 255 | oxidoreductase; Validated | 99.43 | |
| PRK12744 | 257 | short chain dehydrogenase; Provisional | 99.41 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 99.41 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 99.41 | |
| PRK07041 | 230 | short chain dehydrogenase; Provisional | 99.41 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 99.41 | |
| PRK07775 | 274 | short chain dehydrogenase; Provisional | 99.39 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 99.37 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 99.37 | |
| TIGR02632 | 676 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc | 99.37 | |
| KOG1199 | 260 | consensus Short-chain alcohol dehydrogenase/3-hydr | 99.37 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 99.37 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 99.35 | |
| COG1028 | 251 | FabG Dehydrogenases with different specificities ( | 99.34 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 99.34 | |
| PRK08177 | 225 | short chain dehydrogenase; Provisional | 99.34 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.34 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 99.34 | |
| PRK12745 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 99.33 | |
| PRK09134 | 258 | short chain dehydrogenase; Provisional | 99.33 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.32 | |
| PRK09730 | 247 | putative NAD(P)-binding oxidoreductase; Provisiona | 99.31 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 99.31 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 99.31 | |
| PLN00015 | 308 | protochlorophyllide reductase | 99.3 | |
| PRK06077 | 252 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.3 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 99.28 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.27 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 99.23 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 99.22 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 99.21 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 99.21 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 99.19 | |
| TIGR01830 | 239 | 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re | 99.19 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 99.19 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 99.17 | |
| TIGR01289 | 314 | LPOR light-dependent protochlorophyllide reductase | 99.16 | |
| PRK12825 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.11 | |
| COG0623 | 259 | FabI Enoyl-[acyl-carrier-protein] | 99.11 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 99.11 | |
| PRK06953 | 222 | short chain dehydrogenase; Provisional | 99.08 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 99.07 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.07 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.07 | |
| PRK08219 | 227 | short chain dehydrogenase; Provisional | 99.03 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 98.97 | |
| PRK07453 | 322 | protochlorophyllide oxidoreductase; Validated | 98.81 | |
| KOG1208 | 314 | consensus Dehydrogenases with different specificit | 98.5 | |
| PF08643 | 299 | DUF1776: Fungal family of unknown function (DUF177 | 98.45 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 98.23 | |
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 98.23 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 98.18 | |
| smart00822 | 180 | PKS_KR This enzymatic domain is part of bacterial | 98.0 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.0 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 97.72 | |
| PRK13656 | 398 | trans-2-enoyl-CoA reductase; Provisional | 97.71 | |
| PLN02583 | 297 | cinnamoyl-CoA reductase | 97.31 | |
| KOG4022 | 236 | consensus Dihydropteridine reductase DHPR/QDPR [Am | 97.04 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 97.02 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 96.8 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 96.7 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 96.53 | |
| PLN00198 | 338 | anthocyanidin reductase; Provisional | 96.46 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 96.36 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 96.23 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 95.86 | |
| TIGR01746 | 367 | Thioester-redct thioester reductase domain. It has | 95.76 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 95.55 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 95.44 | |
| PRK10217 | 355 | dTDP-glucose 4,6-dehydratase; Provisional | 95.43 | |
| KOG1478 | 341 | consensus 3-keto sterol reductase [Lipid transport | 95.38 | |
| KOG1502 | 327 | consensus Flavonol reductase/cinnamoyl-CoA reducta | 95.35 | |
| PF08659 | 181 | KR: KR domain; InterPro: IPR013968 This domain is | 95.28 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 94.19 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 93.8 | |
| PF01370 | 236 | Epimerase: NAD dependent epimerase/dehydratase fam | 93.77 | |
| PRK10084 | 352 | dTDP-glucose 4,6 dehydratase; Provisional | 92.64 | |
| TIGR01179 | 328 | galE UDP-glucose-4-epimerase. This enzyme intercon | 92.17 | |
| PRK10675 | 338 | UDP-galactose-4-epimerase; Provisional | 90.46 | |
| PF02719 | 293 | Polysacc_synt_2: Polysaccharide biosynthesis prote | 88.46 | |
| TIGR01214 | 287 | rmlD dTDP-4-dehydrorhamnose reductase. This enzyme | 88.09 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 87.29 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 86.51 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 86.46 | |
| PLN02725 | 306 | GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas | 85.51 | |
| TIGR01472 | 343 | gmd GDP-mannose 4,6-dehydratase. Excluded from thi | 84.78 | |
| COG1088 | 340 | RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope | 84.11 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 82.35 | |
| PRK11150 | 308 | rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro | 82.21 | |
| TIGR02197 | 314 | heptose_epim ADP-L-glycero-D-manno-heptose-6-epime | 81.89 |
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.93 E-value=2.3e-25 Score=159.78 Aligned_cols=131 Identities=20% Similarity=0.163 Sum_probs=107.7
Q ss_pred CcccccceEEEeeecCCcccccCCccchhhHHHHHHHHHHHHhhhccCCcEEEEEecCceecCCcccchhhhcCCCCCCC
Q 031734 1 MLRYYLAKIVPAYYQGGKKIKYRHKRKVASKAALHSLTDTLRLELGHFGINVINVVPGAVKSNIGKSAIASYNRMPEWKL 80 (153)
Q Consensus 1 m~~~~~g~ii~isS~~~~~~~p~~~~Y~asK~al~~~~~~l~~el~~~gI~v~~v~PG~v~T~~~~~~~~~~~~~~~~~~ 80 (153)
|++++.|+||||+|.+|+.|.|..++|++||+++.+|+++|+.|+.++||+|.+||||++.|+|+.........
T Consensus 130 m~~~~~G~IiNI~S~ag~~p~p~~avY~ATKa~v~~fSeaL~~EL~~~gV~V~~v~PG~~~T~f~~~~~~~~~~------ 203 (265)
T COG0300 130 MVERGAGHIINIGSAAGLIPTPYMAVYSATKAFVLSFSEALREELKGTGVKVTAVCPGPTRTEFFDAKGSDVYL------ 203 (265)
T ss_pred HHhcCCceEEEEechhhcCCCcchHHHHHHHHHHHHHHHHHHHHhcCCCeEEEEEecCcccccccccccccccc------
Confidence 67899999999999999999999999999999999999999999999999999999999999999732110000
Q ss_pred chHHHHHHHHHhhhccCCCCCCHHHHHHHHHHHHhcCCCCceEeccc-hhHHHHHHHhcchhhHHHHHHhhhc
Q 031734 81 YKPFEAVIRERAYFSQTTKSTPTEVFAKNTVATVLKNNPPAWFSFGH-YSTIMAIMYHLPLSVKDFIMKKTMK 152 (153)
Q Consensus 81 ~~~~~~~~~~~~~~~~~~~~~~~e~va~~i~~~~~~~~~~~~~~~g~-~~~~~~~~~~lP~~~~~~~~~~~~~ 152 (153)
.......++||++|+.+++++...+ ...++|. +.......+.+|..++.+++.+.++
T Consensus 204 -------------~~~~~~~~~~~~va~~~~~~l~~~k--~~ii~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 261 (265)
T COG0300 204 -------------LSPGELVLSPEDVAEAALKALEKGK--REIIPGLPNKALALSFRLLPRSLREKLAGKIFK 261 (265)
T ss_pred -------------ccchhhccCHHHHHHHHHHHHhcCC--ceEecChhhHHHHHHHHHhHHHHHHHHHHHHHH
Confidence 0112255799999999999998874 6777774 3345556789999999999887664
|
|
| >KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05599 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05693 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07904 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B | Back alignment and domain information |
|---|
| >PRK08690 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08340 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06603 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK07984 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08594 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06997 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08415 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07370 enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07533 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08159 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05650 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02730 enoyl-[acyl-carrier-protein] reductase | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06101 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06300 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07102 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08303 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12747 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07832 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK07889 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01500 sepiapter_red sepiapterin reductase | Back alignment and domain information |
|---|
| >PRK06940 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06398 aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07791 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >PRK08936 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05884 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08017 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12743 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07578 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07677 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12938 acetyacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06483 dihydromonapterin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02685 pter_reduc_Leis pteridine reductase | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08063 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02415 23BDH acetoin reductases | Back alignment and domain information |
|---|
| >PRK09009 C factor cell-cell signaling protein; Provisional | Back alignment and domain information |
|---|
| >PRK07069 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12824 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06947 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06181 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12935 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07023 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06123 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06924 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10538 malonic semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >PRK12744 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PRK07041 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07775 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK12746 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08177 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09134 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09730 putative NAD(P)-binding oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00015 protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01289 LPOR light-dependent protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >COG0623 FabI Enoyl-[acyl-carrier-protein] | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06953 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK08219 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07453 protochlorophyllide oxidoreductase; Validated | Back alignment and domain information |
|---|
| >KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >PRK13656 trans-2-enoyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02583 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >PLN00198 anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01746 Thioester-redct thioester reductase domain | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK10217 dTDP-glucose 4,6-dehydratase; Provisional | Back alignment and domain information |
|---|
| >KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor | Back alignment and domain information |
|---|
| >PRK10084 dTDP-glucose 4,6 dehydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR01179 galE UDP-glucose-4-epimerase | Back alignment and domain information |
|---|
| >PRK10675 UDP-galactose-4-epimerase; Provisional | Back alignment and domain information |
|---|
| >PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases | Back alignment and domain information |
|---|
| >TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase | Back alignment and domain information |
|---|
| >TIGR01472 gmd GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional | Back alignment and domain information |
|---|
| >TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 153 | |||
| 1jtv_A | 327 | 17 beta-hydroxysteroid dehydrogenase type 1; stero | 8e-15 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 3e-10 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 4e-10 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 4e-10 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 7e-10 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 1e-09 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 2e-09 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 5e-09 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 6e-09 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 4e-08 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 1e-07 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 2e-07 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 2e-07 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 5e-07 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 6e-07 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 6e-07 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 8e-07 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 3e-06 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 8e-06 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 1e-05 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 1e-05 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 2e-05 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 2e-05 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 3e-05 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 4e-05 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 4e-05 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 5e-05 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 5e-05 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 6e-05 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 6e-05 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 6e-05 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 6e-05 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 7e-05 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 7e-05 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 9e-05 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 1e-04 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 1e-04 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 1e-04 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 1e-04 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 1e-04 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 1e-04 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 1e-04 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 2e-04 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 2e-04 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 2e-04 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 2e-04 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 2e-04 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 2e-04 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 2e-04 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 2e-04 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 2e-04 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 3e-04 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 3e-04 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 3e-04 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 3e-04 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 3e-04 | |
| 4e4y_A | 244 | Short chain dehydrogenase family protein; structur | 3e-04 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 3e-04 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 3e-04 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 3e-04 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 4e-04 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 4e-04 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 4e-04 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 4e-04 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 4e-04 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 4e-04 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 5e-04 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 5e-04 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 5e-04 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 5e-04 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 5e-04 | |
| 1zmo_A | 244 | Halohydrin dehalogenase; haloalcohol dehalogenase, | 5e-04 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 6e-04 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 6e-04 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 7e-04 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 7e-04 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 7e-04 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 7e-04 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 8e-04 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 9e-04 |
| >1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 | Back alignment and structure |
|---|
Score = 69.0 bits (169), Expect = 8e-15
Identities = 21/127 (16%), Positives = 43/127 (33%), Gaps = 5/127 (3%)
Query: 29 ASKAALHSLTDTLRLELGHFGINVINVVPGAVKSNIGKSAIASYNRMPEWK---LYKPFE 85
ASK AL L ++L + L FG+++ + G V + + + S + + + F
Sbjct: 157 ASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFY 216
Query: 86 AVIRERAYFSQTTKSTPTEVFAKNTVATVLKNNPPAWFSFGHYSTIMAIMYHLPLSVKDF 145
+ + P EV A+ + + P + + M L
Sbjct: 217 QYLAHSKQVFREAAQNPEEV-AEVFLTALRAPKPTLRYFTTERFLPLLRM-RLDDPSGSN 274
Query: 146 IMKKTMK 152
+ +
Sbjct: 275 YVTAMHR 281
|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 | Back alignment and structure |
|---|
| >4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 | Back alignment and structure |
|---|
| >1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 153 | |||
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 99.93 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 99.93 | |
| 4hp8_A | 247 | 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi | 99.92 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 99.92 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 99.91 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 99.91 | |
| 4h15_A | 261 | Short chain alcohol dehydrogenase-related dehydro; | 99.91 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 99.9 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 99.87 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 99.83 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 99.82 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 99.82 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 99.81 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 99.81 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 99.8 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 99.8 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 99.8 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.8 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 99.8 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 99.8 | |
| 1jtv_A | 327 | 17 beta-hydroxysteroid dehydrogenase type 1; stero | 99.8 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 99.79 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 99.79 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 99.79 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 99.79 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 99.79 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 99.79 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 99.79 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 99.79 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 99.79 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 99.78 | |
| 1zmo_A | 244 | Halohydrin dehalogenase; haloalcohol dehalogenase, | 99.78 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 99.78 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 99.78 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 99.78 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 99.78 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 99.78 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 99.78 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 99.78 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 99.78 | |
| 3lt0_A | 329 | Enoyl-ACP reductase; triclosan, triclosan variant, | 99.78 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 99.78 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 99.78 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 99.77 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 99.77 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 99.77 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.77 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 99.77 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 99.77 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 99.77 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 99.77 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 99.77 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 99.77 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 99.77 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 99.77 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 99.77 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 99.77 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 99.77 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 99.76 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 99.76 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 99.76 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 99.76 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 99.76 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 99.75 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 99.75 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 99.75 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 99.75 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 99.75 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 99.75 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 99.75 | |
| 4e4y_A | 244 | Short chain dehydrogenase family protein; structur | 99.75 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 99.75 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 99.75 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 99.75 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.75 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 99.75 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 99.75 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 99.75 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.75 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 99.74 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 99.74 | |
| 3icc_A | 255 | Putative 3-oxoacyl-(acyl carrier protein) reducta; | 99.74 | |
| 1e7w_A | 291 | Pteridine reductase; dihydrofolate reductase, shor | 99.74 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 99.74 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 99.74 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 99.74 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 99.74 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 99.74 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 99.74 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 99.74 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 99.73 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 99.73 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 99.73 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 99.73 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 99.73 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 99.73 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 99.73 | |
| 3s8m_A | 422 | Enoyl-ACP reductase; rossmann fold, oxidoreductase | 99.73 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 99.73 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 99.73 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 99.73 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 99.73 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 99.73 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 99.73 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 99.73 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 99.73 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 99.72 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 99.72 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 99.72 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 99.72 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 99.72 | |
| 2o2s_A | 315 | Enoyl-acyl carrier reductase; enoyl reductase, tri | 99.72 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 99.72 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 99.72 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 99.72 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 99.72 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 99.72 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 99.72 | |
| 2ptg_A | 319 | Enoyl-acyl carrier reductase; apicomplexa, enoyl ( | 99.72 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 99.72 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 99.72 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 99.71 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.71 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 99.71 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 99.71 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 99.71 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 99.71 | |
| 1d7o_A | 297 | Enoyl-[acyl-carrier protein] reductase (NADH) PRE; | 99.71 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 99.71 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 99.71 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 99.71 | |
| 3u0b_A | 454 | Oxidoreductase, short chain dehydrogenase/reducta | 99.71 | |
| 1qsg_A | 265 | Enoyl-[acyl-carrier-protein] reductase; enoyl redu | 99.71 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 99.7 | |
| 2pd4_A | 275 | Enoyl-[acyl-carrier-protein] reductase [NADH]; ant | 99.7 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 99.7 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 99.7 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 99.7 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 99.7 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 99.7 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 99.7 | |
| 2wyu_A | 261 | Enoyl-[acyl carrier protein] reductase; oxidoreduc | 99.7 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 99.7 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 99.7 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 99.7 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 99.69 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 99.69 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 99.69 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 99.69 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 99.69 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 99.69 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 99.69 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 99.69 | |
| 3zu3_A | 405 | Putative reductase YPO4104/Y4119/YP_4011; oxidored | 99.68 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 99.68 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 99.68 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 99.68 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 99.68 | |
| 2h7i_A | 269 | Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi | 99.68 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 99.68 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 99.68 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 99.68 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 99.68 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 99.67 | |
| 3uce_A | 223 | Dehydrogenase; rossmann fold, oxidoreductase; HET: | 99.67 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 99.67 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 99.66 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 99.66 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 99.65 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 99.64 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 99.64 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 99.64 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 99.63 | |
| 1edo_A | 244 | Beta-keto acyl carrier protein reductase; nucleoti | 99.63 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 99.63 | |
| 4eue_A | 418 | Putative reductase CA_C0462; TER, biofuel, synthet | 99.63 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 99.63 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 99.63 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 99.62 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 99.62 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 99.62 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 99.62 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 99.61 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 99.61 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 99.61 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 99.61 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 99.61 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 99.6 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 99.59 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 99.59 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 99.59 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 99.59 | |
| 2ph3_A | 245 | 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 | 99.58 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 99.58 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 99.57 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 99.57 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 99.57 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 99.56 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 99.56 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 99.56 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 99.55 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 99.54 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 99.54 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 99.52 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 99.52 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 99.52 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 99.52 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 99.51 | |
| 1gz6_A | 319 | Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF | 99.51 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 99.5 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 99.48 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 99.48 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 99.39 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 99.39 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 99.29 | |
| 3qp9_A | 525 | Type I polyketide synthase pikaii; rossmann fold, | 99.28 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 99.28 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 99.22 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 99.21 | |
| 3mje_A | 496 | AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. | 98.94 | |
| 2z5l_A | 511 | Tylkr1, tylactone synthase starter module and modu | 98.91 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 98.88 | |
| 2fr1_A | 486 | Erythromycin synthase, eryai; short chain dehydrog | 98.8 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 98.78 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 98.7 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 98.69 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 98.68 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 98.66 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 98.51 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 98.37 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 98.34 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 98.34 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 98.33 | |
| 1kew_A | 361 | RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo | 98.27 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 98.19 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 98.18 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 98.16 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 98.15 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 98.15 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 98.14 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 98.13 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 98.12 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 98.11 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 98.07 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 97.97 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 97.97 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 97.94 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 97.93 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 97.92 | |
| 1r6d_A | 337 | TDP-glucose-4,6-dehydratase; rossmann fold, short- | 97.89 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 97.88 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 97.8 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 97.73 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 97.67 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 97.67 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 97.62 | |
| 1gy8_A | 397 | UDP-galactose 4-epimerase; oxidoreductase; HET: NA | 97.61 | |
| 2p5y_A | 311 | UDP-glucose 4-epimerase; TTHA0591, structural geno | 97.61 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 97.58 | |
| 4ggo_A | 401 | Trans-2-enoyl-COA reductase; rossmann fold, oxidor | 97.55 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 97.52 | |
| 1i24_A | 404 | Sulfolipid biosynthesis protein SQD1; SDR, short-c | 97.52 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 97.48 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 97.47 | |
| 1eq2_A | 310 | ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin | 97.47 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 97.47 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 97.42 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 97.37 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 97.34 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 97.33 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 97.31 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 97.29 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 97.27 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 97.24 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 97.22 | |
| 2ggs_A | 273 | 273AA long hypothetical DTDP-4-dehydrorhamnose red | 97.19 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 97.15 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 97.12 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 97.1 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 97.09 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 97.09 | |
| 4b8w_A | 319 | GDP-L-fucose synthase; oxidoreductase; HET: NAP GD | 97.08 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 97.08 | |
| 1udb_A | 338 | Epimerase, UDP-galactose-4-epimerase; isomerase; H | 97.08 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 97.06 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 97.05 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 97.04 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 97.0 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 96.98 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 96.91 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 96.81 | |
| 1db3_A | 372 | GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya | 96.79 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 96.78 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 96.74 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 96.7 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 96.67 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 96.67 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 96.66 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 96.63 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 96.61 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 96.59 | |
| 4f6l_B | 508 | AUSA reductase domain protein; thioester reductase | 96.38 | |
| 1z45_A | 699 | GAL10 bifunctional protein; epimerase, mutarotase, | 96.33 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 96.25 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 96.06 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 96.05 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 91.76 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 88.88 |
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
Probab=99.93 E-value=1.9e-26 Score=164.07 Aligned_cols=112 Identities=21% Similarity=0.121 Sum_probs=90.6
Q ss_pred cccccceEEEeeecCCcccccCCccchhhHHHHHHHHHHHHhhhccCCcEEEEEecCceecCCcccchhhhcCCCCCCCc
Q 031734 2 LRYYLAKIVPAYYQGGKKIKYRHKRKVASKAALHSLTDTLRLELGHFGINVINVVPGAVKSNIGKSAIASYNRMPEWKLY 81 (153)
Q Consensus 2 ~~~~~g~ii~isS~~~~~~~p~~~~Y~asK~al~~~~~~l~~el~~~gI~v~~v~PG~v~T~~~~~~~~~~~~~~~~~~~ 81 (153)
++++.|+|||+||.++..+.|+...|++||+|+.+|+++|+.|+.++|||||+|+||+|+|++...... -
T Consensus 122 m~~~~G~IVnisS~~~~~~~~~~~~Y~asKaav~~ltr~lA~Ela~~gIrVNaV~PG~i~T~m~~~~~~----------~ 191 (242)
T 4b79_A 122 LAQRGGSILNIASMYSTFGSADRPAYSASKGAIVQLTRSLACEYAAERIRVNAIAPGWIDTPLGAGLKA----------D 191 (242)
T ss_dssp HHHHCEEEEEECCGGGTSCCSSCHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEECSBCCC-----CC----------C
T ss_pred HHHcCCeEEEEeeccccCCCCCCHHHHHHHHHHHHHHHHHHHHhhhcCeEEEEEEeCCCCChhhhcccC----------C
Confidence 456679999999999999999999999999999999999999999999999999999999999765420 1
Q ss_pred hHHHHHHHHHhhhccCCCCCCHHHHHHHHHHHHhcCCCCceEeccchh
Q 031734 82 KPFEAVIRERAYFSQTTKSTPTEVFAKNTVATVLKNNPPAWFSFGHYS 129 (153)
Q Consensus 82 ~~~~~~~~~~~~~~~~~~~~~~e~va~~i~~~~~~~~~~~~~~~g~~~ 129 (153)
.+..+.+.+..|.. +..+|||+|+.++ ++.+ +.+.|++|+..
T Consensus 192 ~~~~~~~~~~~Plg---R~g~peeiA~~v~--fLaS-d~a~~iTG~~l 233 (242)
T 4b79_A 192 VEATRRIMQRTPLA---RWGEAPEVASAAA--FLCG-PGASFVTGAVL 233 (242)
T ss_dssp HHHHHHHHHTCTTC---SCBCHHHHHHHHH--HHTS-GGGTTCCSCEE
T ss_pred HHHHHHHHhcCCCC---CCcCHHHHHHHHH--HHhC-chhcCccCceE
Confidence 22334444455544 6789999999999 9998 58899999753
|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A | Back alignment and structure |
|---|
| >1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* | Back alignment and structure |
|---|
| >2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* | Back alignment and structure |
|---|
| >2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 153 | ||||
| d1jtva_ | 285 | c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi | 2e-09 | |
| d1pr9a_ | 244 | c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie | 8e-09 | |
| d2rhca1 | 257 | c.2.1.2 (A:5-261) beta-keto acyl carrier protein r | 3e-08 | |
| d2d1ya1 | 248 | c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T | 3e-08 | |
| d1xu9a_ | 269 | c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase | 5e-08 | |
| d2bd0a1 | 240 | c.2.1.2 (A:2-241) Bacterial sepiapterin reductase | 1e-07 | |
| d1spxa_ | 264 | c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato | 1e-07 | |
| d1xhla_ | 274 | c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh | 4e-07 | |
| d1g0oa_ | 272 | c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase | 5e-07 | |
| d1zema1 | 260 | c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba | 7e-07 | |
| d1sbya1 | 254 | c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase | 8e-07 | |
| d1vl8a_ | 251 | c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga | 1e-06 | |
| d1iy8a_ | 258 | c.2.1.2 (A:) Levodione reductase {Corynebacterium | 1e-06 | |
| d1ydea1 | 250 | c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase | 1e-06 | |
| d1xkqa_ | 272 | c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh | 1e-06 | |
| d1yo6a1 | 250 | c.2.1.2 (A:1-250) Putative carbonyl reductase snif | 2e-06 | |
| d2c07a1 | 251 | c.2.1.2 (A:54-304) beta-keto acyl carrier protein | 2e-06 | |
| d2ae2a_ | 259 | c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu | 2e-06 | |
| d1yb1a_ | 244 | c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase | 2e-06 | |
| d1w6ua_ | 294 | c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr | 5e-06 | |
| d1yxma1 | 297 | c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re | 5e-06 | |
| d1ja9a_ | 259 | c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc | 6e-06 | |
| d2ew8a1 | 247 | c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas | 8e-06 | |
| d1cyda_ | 242 | c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul | 1e-05 | |
| d2ag5a1 | 245 | c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami | 1e-05 | |
| d1hdca_ | 254 | c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr | 1e-05 | |
| d1q7ba_ | 243 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 2e-05 | |
| d1nffa_ | 244 | c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob | 2e-05 | |
| d1ulsa_ | 242 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 2e-05 | |
| d1x1ta1 | 260 | c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge | 2e-05 | |
| d1fmca_ | 255 | c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase | 3e-05 | |
| d1geea_ | 261 | c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat | 4e-05 | |
| d1gz6a_ | 302 | c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do | 4e-05 | |
| d1hxha_ | 253 | c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge | 4e-05 | |
| d2a4ka1 | 241 | c.2.1.2 (A:2-242) beta-keto acyl carrier protein r | 5e-05 | |
| d1xg5a_ | 257 | c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 | 5e-05 | |
| d1ae1a_ | 258 | c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu | 6e-05 | |
| d1o5ia_ | 234 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 8e-05 | |
| d1h5qa_ | 260 | c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga | 1e-04 | |
| d1dhra_ | 236 | c.2.1.2 (A:) Dihydropteridin reductase (pteridine | 1e-04 | |
| d1zk4a1 | 251 | c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase | 2e-04 | |
| d1xq1a_ | 259 | c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara | 2e-04 | |
| d1ooea_ | 235 | c.2.1.2 (A:) Dihydropteridin reductase (pteridine | 2e-04 | |
| d1zmta1 | 252 | c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag | 2e-04 | |
| d1oaaa_ | 259 | c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus | 3e-04 | |
| d1gega_ | 255 | c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl | 5e-04 | |
| d2bgka1 | 268 | c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de | 7e-04 | |
| d1snya_ | 248 | c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly | 0.001 | |
| d1k2wa_ | 256 | c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s | 0.001 | |
| d1mxha_ | 266 | c.2.1.2 (A:) Dihydropteridin reductase (pteridine | 0.001 | |
| d2gdza1 | 254 | c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog | 0.003 | |
| d1wmaa1 | 275 | c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox | 0.003 | |
| d2o23a1 | 248 | c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr | 0.003 |
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Tyrosine-dependent oxidoreductases domain: Human estrogenic 17beta-hydroxysteroid dehydrogenase species: Human (Homo sapiens) [TaxId: 9606]
Score = 52.2 bits (124), Expect = 2e-09
Identities = 24/128 (18%), Positives = 49/128 (38%), Gaps = 6/128 (4%)
Query: 29 ASKAALHSLTDTLRLELGHFGINVINVVPGAVKSNIGKSAIASYNRMPEWKLYKPFEAVI 88
ASK AL L ++L + L FG+++ + G V + + + S + + F
Sbjct: 157 ASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTDIHTFHRFY 216
Query: 89 RERAYFSQTTK---STPTEVFAKNTVATVLKNNPPAWFSFGHYSTIMAIMYHLPLSVKDF 145
+ A+ Q + P EV A+ + + P + + M S ++
Sbjct: 217 QYLAHSKQVFREAAQNPEEV-AEVFLTALRAPKPTLRYFTTERFLPLLRMRLDDPSGSNY 275
Query: 146 I--MKKTM 151
+ M + +
Sbjct: 276 VTAMHREV 283
|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 | Back information, alignment and structure |
|---|
| >d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 153 | |||
| d1jtva_ | 285 | Human estrogenic 17beta-hydroxysteroid dehydrogena | 99.93 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 99.92 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 99.91 | |
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 99.91 | |
| d1zmta1 | 252 | Halohydrin dehalogenase HheC {Agrobacterium tumefa | 99.91 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 99.91 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 99.91 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 99.9 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 99.9 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 99.9 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 99.9 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 99.9 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 99.9 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 99.9 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 99.9 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 99.89 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 99.89 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 99.89 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 99.88 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 99.88 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 99.88 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 99.88 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 99.88 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 99.88 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 99.88 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 99.88 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 99.88 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 99.87 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 99.87 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 99.87 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 99.87 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 99.87 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 99.87 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 99.87 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 99.87 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 99.86 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 99.86 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 99.86 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 99.86 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 99.85 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 99.85 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 99.84 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 99.84 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 99.83 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 99.82 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 99.82 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 99.81 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 99.81 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 99.81 | |
| d1uh5a_ | 329 | Enoyl-ACP reductase {Malaria parasite (Plasmodium | 99.8 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 99.8 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 99.8 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 99.79 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 99.78 | |
| d1e7wa_ | 284 | Dihydropteridin reductase (pteridine reductase) {L | 99.77 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 99.77 | |
| d1mxha_ | 266 | Dihydropteridin reductase (pteridine reductase) {T | 99.77 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 99.75 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 99.75 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 99.73 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 99.7 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 99.67 | |
| d1snya_ | 248 | Carbonyl reductase sniffer {Fruit fly (Drosophila | 99.66 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 99.58 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 99.58 | |
| d2fr1a1 | 259 | Erythromycin synthase, eryAI, 1st ketoreductase mo | 99.39 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 95.1 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 94.69 | |
| d1r6da_ | 322 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces | 94.56 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 93.89 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 92.34 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 91.74 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 90.97 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 90.57 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 89.91 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 89.56 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 89.11 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 84.23 |
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Tyrosine-dependent oxidoreductases domain: Human estrogenic 17beta-hydroxysteroid dehydrogenase species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.93 E-value=5.7e-27 Score=169.26 Aligned_cols=130 Identities=16% Similarity=0.109 Sum_probs=93.2
Q ss_pred CcccccceEEEeeecCCcccccCCccchhhHHHHHHHHHHHHhhhccCCcEEEEEecCceecCCcccchhh---hcCCCC
Q 031734 1 MLRYYLAKIVPAYYQGGKKIKYRHKRKVASKAALHSLTDTLRLELGHFGINVINVVPGAVKSNIGKSAIAS---YNRMPE 77 (153)
Q Consensus 1 m~~~~~g~ii~isS~~~~~~~p~~~~Y~asK~al~~~~~~l~~el~~~gI~v~~v~PG~v~T~~~~~~~~~---~~~~~~ 77 (153)
|++++.|+|||+||.+|..+.|+.+.|++||+|+.+|+++|+.|+.++||+||+|+||+|+|++....... ..+..+
T Consensus 129 m~~~~~G~Iv~isS~~g~~~~~~~~~Y~asKaal~~l~~~la~El~~~gIrVn~V~PG~v~T~~~~~~~~~~~~~~~~~~ 208 (285)
T d1jtva_ 129 MKRRGSGRVLVTGSVGGLMGLPFNDVYCASKFALEGLCESLAVLLLPFGVHLSLIECGPVHTAFMEKVLGSPEEVLDRTD 208 (285)
T ss_dssp HHHHTCEEEEEEEEGGGTSCCTTCHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEEEECCBCC-------CCHHHHHHTSC
T ss_pred HHHcCCCceEEEechhhcCCCCCchHHHHHHHHHHHHHHHHHHHhhccCcEEEEEecCCCCChHHHHhccCHHHHhhccc
Confidence 56788899999999999999999999999999999999999999999999999999999999998764311 000111
Q ss_pred CCCchHHHHHHHHHhhhccCCCCCCHHHHHHHHHHHHhcCCCCceEeccchhHH
Q 031734 78 WKLYKPFEAVIRERAYFSQTTKSTPTEVFAKNTVATVLKNNPPAWFSFGHYSTI 131 (153)
Q Consensus 78 ~~~~~~~~~~~~~~~~~~~~~~~~~~e~va~~i~~~~~~~~~~~~~~~g~~~~~ 131 (153)
...++...+......+.. ..+..+||+||+++++++..++|..+|++|.....
T Consensus 209 ~~~~~~~~~~~~~~~~~~-~~~~~~PeeVA~~v~~~~~~~~p~~ry~~g~~~~~ 261 (285)
T d1jtva_ 209 IHTFHRFYQYLAHSKQVF-REAAQNPEEVAEVFLTALRAPKPTLRYFTTERFLP 261 (285)
T ss_dssp HHHHHHHHHHHHHHHHHH-HHHCBCHHHHHHHHHHHHHCSSCCSEEESCSTTHH
T ss_pred hhHHHHHHHHHHHHhhhh-cccCCCHHHHHHHHHHHHhCCCCCeEEecHHHHHH
Confidence 011122222221111111 11446999999999999999888899999987643
|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|