BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031735
         (153 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3RFU|A Chain A, Crystal Structure Of A Copper-Transporting Pib-Type Atpase
 pdb|3RFU|B Chain B, Crystal Structure Of A Copper-Transporting Pib-Type Atpase
 pdb|3RFU|C Chain C, Crystal Structure Of A Copper-Transporting Pib-Type Atpase
 pdb|3RFU|D Chain D, Crystal Structure Of A Copper-Transporting Pib-Type Atpase
          Length = 736

 Score = 28.5 bits (62), Expect = 1.4,   Method: Composition-based stats.
 Identities = 14/31 (45%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query: 48  LIPHAFNSVEILWTFSIYLEAVAILPQLVLL 78
           + PHAF S E     ++Y EA A++  LVLL
Sbjct: 172 VFPHAFRSQE--GVVAVYFEAAAVITTLVLL 200


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.330    0.143    0.462 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,719,426
Number of Sequences: 62578
Number of extensions: 180025
Number of successful extensions: 391
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 391
Number of HSP's gapped (non-prelim): 2
length of query: 153
length of database: 14,973,337
effective HSP length: 90
effective length of query: 63
effective length of database: 9,341,317
effective search space: 588502971
effective search space used: 588502971
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 47 (22.7 bits)