Citrus Sinensis ID: 031739


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MASGNLPRRIVKETQRLLSEPAPGISASPAEDNMRYFNVMILGPSQSPYEGGVFKLELFLPEDYPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSDNIAKHWKADETEAVETAKEWTRLYASDG
ccccccccHHHHHHHHHHcccccccEEEEccccccEEEEEEEccccccccccEEEEEEEccccccccccEEEECcccccccccccccEEEEcccccccccccHHHHHHHHHHHHccccccccccHHHHHHHHHcHHHHHHHHHHHHHHHcccc
******P****KETQRLLSEPAPGISASPAEDNMRYFNVMILGPSQSPYEGGVFKLELFLPEDYPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSDNIAKHWKADETEAVETAKEWTRLYAS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASGNLPRRIVKETQRLLSEPAPGISASPAEDNMRYFNVMILGPSQSPYEGGVFKLELFLPEDYPMSAPKVRFLTKIYHPNIDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLSDNIAKHWKADETEAVETAKEWTRLYASDG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-conjugating enzyme E2 36 Catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Required for postreplication repair of UV-damaged DNA and for adaptating root developmental programs to suboptimal availability of iron.confidentQ9FZ48
Ubiquitin-conjugating enzyme E2 35 Catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through 'Lys-63'. This type of poly-ubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Required for postreplication repair of UV-damaged DNA and for adaptating root developmental programs to suboptimal availability of iron.confidentQ94A97
Ubiquitin-conjugating enzyme E2 N The UBE2V1-UBE2N and UBE2V2-UBE2N heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains. This type of polyubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Acts together with the E3 ligases, HLTF and SHPRH, in the 'Lys-63'-linked poly-ubiquitination of PCNA upon genotoxic stress, which is required for DNA repair. Appears to act together with E3 ligase RNF5 in the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD.confidentP61088

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.3.-.-Forming carbon-nitrogen bonds.probable
6.3.2.-Acid--D-amino-acid ligases (peptide synthases).probable
6.3.2.19Ubiquitin--protein ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2C2V, chain B
Confidence level:very confident
Coverage over the Query: 2-152
View the alignment between query and template
View the model in PyMOL