Query         031740
Match_columns 153
No_of_seqs    110 out of 262
Neff          6.1 
Searched_HMMs 46136
Date          Fri Mar 29 04:42:07 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031740.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/031740hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00178 STI Soybean trypsin in 100.0 1.1E-39 2.5E-44  255.1  12.8  111   32-151     1-139 (172)
  2 smart00452 STI Soybean trypsin 100.0 1.9E-38 4.2E-43  248.2  12.8  110   33-152     1-137 (172)
  3 PF00197 Kunitz_legume:  Trypsi 100.0 4.1E-38   9E-43  246.8  11.6  113   32-152     1-143 (176)
  4 PF02402 Lysis_col:  Lysis prot  63.8     6.4 0.00014   24.5   2.0   18   28-45     19-36  (46)
  5 PF07172 GRP:  Glycine rich pro  58.7     6.2 0.00013   28.1   1.5   11   33-43     32-42  (95)
  6 PF12702 Lipocalin_3:  Lipocali  55.3     9.8 0.00021   27.0   2.1   45   96-146    42-92  (93)
  7 PF05474 Semenogelin:  Semenoge  53.7     7.3 0.00016   35.7   1.4   15    1-15      1-15  (582)
  8 PF14009 DUF4228:  Domain of un  50.4      11 0.00023   28.1   1.7   21   36-56     64-84  (181)
  9 PF10657 RC-P840_PscD:  Photosy  49.5      17 0.00038   27.5   2.6   30   37-66     24-54  (144)
 10 PF03831 PhnA:  PhnA protein;    49.4     8.1 0.00018   25.2   0.7   19   32-50      1-19  (56)
 11 COG2824 PhnA Uncharacterized Z  47.0      20 0.00043   26.4   2.6   22   31-52     43-64  (112)
 12 COG5510 Predicted small secret  46.1      16 0.00035   22.6   1.7   17    1-17      2-18  (44)
 13 PRK10220 hypothetical protein;  44.8      24 0.00052   26.0   2.7   22   31-52     42-63  (111)
 14 TIGR00686 phnA alkylphosphonat  44.3      24 0.00052   26.0   2.6   22   31-52     41-62  (109)
 15 TIGR02588 conserved hypothetic  41.4 1.4E+02  0.0031   22.3   6.5   57   29-85     33-93  (122)
 16 PF08194 DIM:  DIM protein;  In  39.6      47   0.001   19.7   2.9   16    1-17      1-16  (36)
 17 PF09466 Yqai:  Hypothetical pr  38.4      24 0.00053   24.0   1.8   20   32-51     25-44  (71)
 18 COG1999 Uncharacterized protei  35.8      13 0.00028   29.7   0.1    9  144-152    76-84  (207)
 19 COG5402 Uncharacterized conser  35.7 1.6E+02  0.0036   23.5   6.3   28   33-66     79-107 (194)
 20 PF15284 PAGK:  Phage-encoded v  34.1      28 0.00061   23.0   1.5   17    1-17      1-19  (61)
 21 KOG3352 Cytochrome c oxidase,   33.5      53  0.0011   25.6   3.2   36  109-148   109-149 (153)
 22 PLN03207 stomagen; Provisional  33.3      46   0.001   24.3   2.6   12    6-17     12-23  (113)
 23 PF15240 Pro-rich:  Proline-ric  33.1      36 0.00079   27.1   2.3   13    5-17      2-14  (179)
 24 PF10813 DUF2733:  Protein of u  32.9      25 0.00054   20.4   1.0   19   29-47     11-29  (32)
 25 KOG3858 Ephrin, ligand for Eph  32.2      33 0.00072   28.4   2.0   21   36-56    116-136 (233)
 26 PF15165 REC114-like:  Meiotic   32.1      70  0.0015   26.7   3.9   21   94-114    27-47  (243)
 27 PF00879 Defensin_propep:  Defe  31.9      48   0.001   21.2   2.3   18    1-19      1-18  (52)
 28 KOG2792 Putative cytochrome C   30.6      33 0.00072   29.1   1.8    9  144-152   148-156 (280)
 29 PF05550 Peptidase_C53:  Pestiv  30.6      31 0.00067   26.9   1.5   17   28-44     19-35  (168)
 30 PRK13701 psiB plasmid SOS inhi  29.0      85  0.0018   24.1   3.6   11   91-101    77-90  (144)
 31 PRK10159 outer membrane phosph  28.7      55  0.0012   28.0   2.9   17   29-45     20-36  (351)
 32 PRK01904 hypothetical protein;  27.6 3.1E+02  0.0066   22.1   6.9   12   32-43     31-42  (219)
 33 PF07951 Toxin_R_bind_C:  Clost  27.1      61  0.0013   26.5   2.7   99   30-137     7-146 (214)
 34 PF00812 Ephrin:  Ephrin;  Inte  26.8      45 0.00097   25.5   1.8   20   37-56    101-120 (145)
 35 PRK11289 ampC beta-lactamase/D  26.0      35 0.00076   29.7   1.2   15    1-15      2-16  (384)
 36 PHA02283 hypothetical protein   24.9      71  0.0015   25.7   2.6   18   41-58     44-61  (210)
 37 PF13209 DUF4017:  Protein of u  22.9      77  0.0017   20.7   2.0   40    1-47      1-40  (60)
 38 PF12262 Lipase_bact_N:  Bacter  22.8      30 0.00066   29.0   0.2   26   40-65    161-188 (268)
 39 COG0301 ThiI Thiamine biosynth  21.1      63  0.0014   28.7   1.8   22   39-60    150-171 (383)

No 1  
>cd00178 STI Soybean trypsin inhibitor (Kunitz) family of protease inhibitors. Inhibit proteases by binding with high affinity to their active sites. Trefoil fold, common to interleukins and fibroblast growth factors.
Probab=100.00  E-value=1.1e-39  Score=255.11  Aligned_cols=111  Identities=44%  Similarity=0.842  Sum_probs=99.0

Q ss_pred             ceeeCCCCeecCCCCEEEEeecCCCCC--------------------------ceEEEecCC-CCceeecCCceEEEecc
Q 031740           32 PLFDVHGNTVQPNCQYYLVSAIPGAGG--------------------------IKLALSPYE-NSTIVRESTDLNLIFPV   84 (153)
Q Consensus        32 ~VlD~~G~~l~~g~~YyI~pa~~g~GG--------------------------lPV~Fs~~~-~~~~I~e~t~lnI~F~~   84 (153)
                      +|+|++||||++|.+|||+|+++|.||                          +||+|+|++ ++++|||+++|||+|..
T Consensus         1 ~VlD~~G~~l~~g~~YyI~p~~~g~GGGl~l~~~~~~~CPl~VvQ~~~~~~~GlPv~Fs~~~~~~~~I~e~t~lnI~F~~   80 (172)
T cd00178           1 PVLDTDGNPLRNGGRYYILPAIRGGGGGLTLAATGNETCPLTVVQSPSELDRGLPVKFSPPNPKSDVIRESTDLNIEFDA   80 (172)
T ss_pred             CcCcCCCCCCcCCCeEEEEEceeCCCCcEEEcCCCCCCCCCeeEECCCCCCCCeeEEEEeCCCCCCEEECCCcEEEEeCC
Confidence            599999999999999999999998654                          999999987 89999999999999998


Q ss_pred             CCCCCccc-CCCCcEEEeccCCCCcceEEEeCCccCCCCCCCCCCcEEEEEeCCCCCCcEEEecCCCc
Q 031740           85 LLSGREYC-NKQSLWKVDNYNASSGIWFVTTGGFVGYPGAETLLNWFKLEKFGTFPGAYKIVHCPSIC  151 (153)
Q Consensus        85 ~~~~~~~C-~~st~W~v~~~~~~~~~~~V~tGg~~g~pg~~t~~~~FkIek~~~~~~~YKLvfCp~vc  151 (153)
                      .    +.| ++|++|+|++.++ .++|+|++||.+++    +.+|||||||++...+.|||+|||++|
T Consensus        81 ~----~~c~~~st~W~V~~~~~-~~~~~V~~Gg~~~~----~~~~~FkIek~~~~~~~YKL~~Cp~~~  139 (172)
T cd00178          81 P----TWCCGSSTVWKVDRDST-PEGLFVTTGGVKGN----TLNSWFKIEKVSEGLNAYKLVFCPSSC  139 (172)
T ss_pred             C----CcCCCCCCEEEEeccCC-ccCeEEEeCCcCCC----cccceEEEEECCCCCCcEEEEEcCCCC
Confidence            8    566 9999999997655 78999999998775    679999999998644679999999875


No 2  
>smart00452 STI Soybean trypsin inhibitor (Kunitz) family of protease inhibitors.
Probab=100.00  E-value=1.9e-38  Score=248.21  Aligned_cols=110  Identities=38%  Similarity=0.781  Sum_probs=97.0

Q ss_pred             eeeCCCCeecCCCCEEEEeecCCCCC--------------------------ceEEEecCC-CCceeecCCceEEEeccC
Q 031740           33 LFDVHGNTVQPNCQYYLVSAIPGAGG--------------------------IKLALSPYE-NSTIVRESTDLNLIFPVL   85 (153)
Q Consensus        33 VlD~~G~~l~~g~~YyI~pa~~g~GG--------------------------lPV~Fs~~~-~~~~I~e~t~lnI~F~~~   85 (153)
                      |+|++||||++|++|||+|++||.||                          +||+|+|++ ++.+|||+++|||+|...
T Consensus         1 VlDt~G~~l~~G~~YyI~p~~~g~GGGl~l~~~~n~~CPl~VvQ~~~~~~~GlPV~Fs~~~~~~~ii~e~t~lnI~F~~~   80 (172)
T smart00452        1 VLDTDGNPLRNGGTYYILPAIRGHGGGLTLAATGNEICPLTVVQSPNEVDNGLPVKFSPPNPSDFIIRESTDLNIEFDAP   80 (172)
T ss_pred             CCCCCCCCCcCCCcEEEEEccccCCCCEEEccCCCCCCCCeeEECCCCCCCceeEEEeecCCCCCEEecCceEEEEeCCC
Confidence            79999999999999999999997644                          999999976 788999999999999987


Q ss_pred             CCCCcccCCCCcEEEeccCCCCcceEEEeCCccCCCCCCCCCCcEEEEEeCCCCCCcEEEecCCCcC
Q 031740           86 LSGREYCNKQSLWKVDNYNASSGIWFVTTGGFVGYPGAETLLNWFKLEKFGTFPGAYKIVHCPSICE  152 (153)
Q Consensus        86 ~~~~~~C~~st~W~v~~~~~~~~~~~V~tGg~~g~pg~~t~~~~FkIek~~~~~~~YKLvfCp~vc~  152 (153)
                          +.|++|++|+|++ ++..++|+|+|||   +|+..  +|||||||++...+.|||+|||++|+
T Consensus        81 ----~~C~~st~W~V~~-~~~~~~~~V~~gg---~~~~~--~~~FkIek~~~~~~~YKLv~Cp~~~~  137 (172)
T smart00452       81 ----PLCAQSTVWTVDE-DSAPEGLAVKTGG---YPGVR--DSWFKIEKYSGESNGYKLVYCPNGSD  137 (172)
T ss_pred             ----CCCCCCCEEEEec-CCccccEEEEeCC---cCCCC--CCeEEEEECCCCCCCEEEEEcCCCCC
Confidence                7899999999995 6678899999998   44443  69999999986446799999998764


No 3  
>PF00197 Kunitz_legume:  Trypsin and protease inhibitor;  InterPro: IPR002160 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.  The Kunitz-type soybean trypsin inhibitor (STI) family consists mainly of proteinase inhibitors from Leguminosae seeds []. They belong to MEROPS inhibitor family I3, clan IC. They exhibit proteinase inhibitory activity against serine proteinases; trypsin (MEROPS peptidase family S1, IPR001254 from INTERPRO) and subtilisin (MEROPS peptidase family S8, IPR000209 from INTERPRO), thiol proteinases (MEROPS peptidase family C1, IPR000668 from INTERPRO) and aspartic proteinases (MEROPS peptidase family A1, IPR001461 from INTERPRO) [].  Inhibitors from cereals are active against subtilisin and endogenous alpha-amylases, while some also inhibit tissue plasminogen activator. The inhibitors are usually specific for either trypsin or chymotrypsin, and some are effective against both. They are thought to protect the seeds against consumption by animal predators, while at the same time existing as seed storage proteins themselves - all the actively inhibitory members contain 2 disulphide bridges. The existence of a member with no inhibitory activity, winged bean albumin 1, suggests that the inhibitors may have evolved from seed storage proteins. Proteins from the Kunitz family contain from 170 to 200 amino acid residues and one or two intra-chain disulphide bonds. The best conserved region is found in their N-terminal section. The crystal structures of soybean trypsin inhibitor (STI), trypsin inhibitor DE-3 from the Kaffir tree Erythrina caffra (ETI) [] and the bifunctional proteinase K/alpha-amylase inhibitor from wheat (PK13) have been solved, showing them to share the same 12-stranded beta-sheet structure as those of interleukin-1 and heparin-binding growth factors []. The beta-sheets are arranged in 3 similar lobes around a central axis, 6 strands forming an anti-parallel beta-barrel. Despite the structural similarity, STI shows no interleukin-1 bioactivity, presumably as a result of their primary sequence disparities. The active inhibitory site containing the scissile bond is located in the loop between beta-strands 4 and 5 in STI and ETI. The STIs belong to a superfamily that also contains the interleukin-1 proteins, heparin binding growth factors (HBGF) and histactophilin, all of which have very similar structures, but share no sequence similarity with the STI family.; GO: 0004866 endopeptidase inhibitor activity; PDB: 3TC2_B 3S8J_A 3S8K_A 1TIE_A 2GZB_A 3E8L_C 2IWT_B 3BX1_C 1AVA_D 3IIR_A ....
Probab=100.00  E-value=4.1e-38  Score=246.82  Aligned_cols=113  Identities=44%  Similarity=0.870  Sum_probs=98.7

Q ss_pred             ceeeCCCCeecCCCCEEEEeecCCCCC--------------------------ceEEEecC--C-CCceeecCCceEEEe
Q 031740           32 PLFDVHGNTVQPNCQYYLVSAIPGAGG--------------------------IKLALSPY--E-NSTIVRESTDLNLIF   82 (153)
Q Consensus        32 ~VlD~~G~~l~~g~~YyI~pa~~g~GG--------------------------lPV~Fs~~--~-~~~~I~e~t~lnI~F   82 (153)
                      ||+|+|||||++|++|||+|+++|.||                          +||+|+|+  . .+++|||+++|||+|
T Consensus         1 pVlD~~G~~l~~g~~YyI~p~~~~~GGGl~l~~~~n~~CPl~Vvq~~~~~~~GlPv~Fs~~~~~~~~~~ir~st~l~I~F   80 (176)
T PF00197_consen    1 PVLDTDGNPLRNGGEYYILPAIRGAGGGLTLAKTGNETCPLDVVQSPSELSRGLPVKFSPPYRNSFDTVIRESTDLNIEF   80 (176)
T ss_dssp             B-BETTSCB-BTTSEEEEEESSTGCSEEEEEECCTTSSSSEEEEEESSTTS-BSEEEEEESSSSSSTBCTBTTSEEEEEE
T ss_pred             CcCCCCCCCCcCCCCEEEEeCccCCCCeeEecCCCCCCCChheEEccCCCCCceeEEEEeCCcccCCCeeEcceEEEEEE
Confidence            699999999999999999999999877                          99999994  3 678999999999999


Q ss_pred             ccCCCCCcccCCCCcEEEeccCCCCcceEEEeCCccCCCCCCCCCCcEEEEEeCC-CCCCcEEEecCCCcC
Q 031740           83 PVLLSGREYCNKQSLWKVDNYNASSGIWFVTTGGFVGYPGAETLLNWFKLEKFGT-FPGAYKIVHCPSICE  152 (153)
Q Consensus        83 ~~~~~~~~~C~~st~W~v~~~~~~~~~~~V~tGg~~g~pg~~t~~~~FkIek~~~-~~~~YKLvfCp~vc~  152 (153)
                      ...    +.|..+++|+|++.++++++ +|+|||.+|   .++.+|||||||++. ..+.|||+|||+.|+
T Consensus        81 ~~~----~~c~~~~~W~V~~~~~~~~~-~V~~gg~~~---~~~~~~~FkIek~~~~~~~~YKLvfCp~~~~  143 (176)
T PF00197_consen   81 SSP----TSCACSTVWKVVKDDPETGQ-FVKTGGVKG---PETVDSWFKIEKYEDGFNNAYKLVFCPSVCC  143 (176)
T ss_dssp             SSE----CTTSSSSBEEEEEETTTTEE-EEEEESSSS---SGCGCCEEEEEEESSSSTTEEEEEEESSSSS
T ss_pred             ccC----CCCCccCEEEEeecCcccce-EEEeCCccc---CCccCcEEEEEEeCCCCCCcEEEEECCCccc
Confidence            988    78999999999987766555 999999877   677899999999997 356899999999764


No 4  
>PF02402 Lysis_col:  Lysis protein;  InterPro: IPR003059 The DNA sequence of the entire colicin E2 operon has been determined []. The operon comprises the colicin activity gene (ceaB), the colicin immunity gene (ceiB) and the lysis gene (celB), which is essential for colicin release from producing cells []. A putative LexA binding site is located upstream from ceaB, and a rho-independent terminator structure is located downstream from celB []. Comparison of the amino acid sequences of colicin E2 and cloacin DF13 reveal extensive similarity. These colicins have different modes of action and recognise different cell surface receptors; the two major regions of heterology at the C terminus, and in the C-terminal end of the central region are thought to correspond to the catalytic and receptor-recognition domains, respectively [].  Sequence similarities between colicins E2, A and E1 [] are less striking. The colicin E2 (pyocin) immunity protein does not share similarity with either the colicin E3 or cloacin DF13 [] immunity proteins. By contrast, the lysis proteins of the ColE2, ColE1 and CloDF13 plasmids are almost identical except in the N-terminal regions, which themselves are similar to lipoprotein signal peptides []. Processing of the ColE2 prolysis protein to the mature form is prevented by globomycin, a specific inhibitor of the lipoprotein signal peptidase []. The mature ColE2 lysis protein is located in the cell envelope [].; GO: 0009405 pathogenesis, 0019835 cytolysis, 0019867 outer membrane
Probab=63.76  E-value=6.4  Score=24.52  Aligned_cols=18  Identities=33%  Similarity=0.479  Sum_probs=14.6

Q ss_pred             CCCCceeeCCCCeecCCC
Q 031740           28 SFPEPLFDVHGNTVQPNC   45 (153)
Q Consensus        28 a~~~~VlD~~G~~l~~g~   45 (153)
                      -|.+-|.|+.|--|.+..
T Consensus        19 CQaN~iRDvqGGtVaPSS   36 (46)
T PF02402_consen   19 CQANYIRDVQGGTVAPSS   36 (46)
T ss_pred             hhhcceecCCCceECCCc
Confidence            566789999999888764


No 5  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=58.72  E-value=6.2  Score=28.14  Aligned_cols=11  Identities=27%  Similarity=0.105  Sum_probs=5.2

Q ss_pred             eeeCCCCeecC
Q 031740           33 LFDVHGNTVQP   43 (153)
Q Consensus        33 VlD~~G~~l~~   43 (153)
                      +...+-|+|+.
T Consensus        32 ~~~~~~~~v~~   42 (95)
T PF07172_consen   32 EKEEEENEVQD   42 (95)
T ss_pred             cccccCCCCCc
Confidence            44444455544


No 6  
>PF12702 Lipocalin_3:  Lipocalin-like;  InterPro: IPR024311 This is a family of proteins of 115 residues on average. There are 16 subunits in each asymmetric unit cell. The interface interaction indicates that the biomolecule of protein Q8A9E6 from SWISSPROT should be a monomer. The family has two highly conserved tryptophan residues. The fold is very similar to the lipocalin-like fold from several comparable structures.; PDB: 3HTY_I.
Probab=55.32  E-value=9.8  Score=27.01  Aligned_cols=45  Identities=20%  Similarity=0.356  Sum_probs=29.6

Q ss_pred             CcEEEeccCCCCcceEEEeCCccCCCCCCCCCCcEEEEEeCCC------CCCcEEEe
Q 031740           96 SLWKVDNYNASSGIWFVTTGGFVGYPGAETLLNWFKLEKFGTF------PGAYKIVH  146 (153)
Q Consensus        96 t~W~v~~~~~~~~~~~V~tGg~~g~pg~~t~~~~FkIek~~~~------~~~YKLvf  146 (153)
                      ..|++..      ..++..|-.+|+.+.......|+|+|...+      +..|.+.|
T Consensus        42 ~~Wk~~g------~~Lil~g~s~Gn~~~~~~~~t~~I~~lt~dsLvL~~~~g~~i~y   92 (93)
T PF12702_consen   42 EKWKLEG------NKLILEGESIGNGQSSEFTDTFDIEKLTSDSLVLKDGEGYTIRY   92 (93)
T ss_dssp             EEEEEET------TEEEEEEEEEETTEEEEEEEEEEEEEE-SSEEEE-EETTEEEEE
T ss_pred             eeEEEcC------CEEEEEEEEccCCccEEEEEEEEEEEeCCCeEEEEcCCcEEEEe
Confidence            4699652      236777777777544456788999999753      34566666


No 7  
>PF05474 Semenogelin:  Semenogelin;  InterPro: IPR008836 This family consists of several mammalian semenogelin (I and II) proteins. Freshly ejaculated Homo sapiens semen has the appearance of a loose gel in which the predominant structural protein components are the seminal vesicle secreted semenogelins (Sg) [].; GO: 0005198 structural molecule activity, 0019953 sexual reproduction, 0005576 extracellular region, 0030141 stored secretory granule
Probab=53.68  E-value=7.3  Score=35.67  Aligned_cols=15  Identities=20%  Similarity=0.284  Sum_probs=11.9

Q ss_pred             CCCchhHHHHHHHHH
Q 031740            1 MKTPLPTTFFFLILT   15 (153)
Q Consensus         1 MK~~~~~~lsfll~a   15 (153)
                      ||++++|.||+||++
T Consensus         1 MK~~I~F~lSLLLiL   15 (582)
T PF05474_consen    1 MKSIIFFVLSLLLIL   15 (582)
T ss_pred             CCceeehHHHHHHHH
Confidence            999999888766654


No 8  
>PF14009 DUF4228:  Domain of unknown function (DUF4228)
Probab=50.35  E-value=11  Score=28.12  Aligned_cols=21  Identities=19%  Similarity=0.276  Sum_probs=17.2

Q ss_pred             CCCCeecCCCCEEEEeecCCC
Q 031740           36 VHGNTVQPNCQYYLVSAIPGA   56 (153)
Q Consensus        36 ~~G~~l~~g~~YyI~pa~~g~   56 (153)
                      .-.++|+.|.-||++|..+-.
T Consensus        64 ~~d~~L~~G~~Y~llP~~~~~   84 (181)
T PF14009_consen   64 PPDEELQPGQIYFLLPMSRLQ   84 (181)
T ss_pred             CccCeecCCCEEEEEEccccC
Confidence            456889999999999987633


No 9  
>PF10657 RC-P840_PscD:  Photosystem P840 reaction centre protein PscD;  InterPro: IPR019608 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product.  The photosynthetic reaction centres (RCs) of aerotolerant organisms contain a heterodimeric core, built up of two strongly homologous polypeptides each of which contributes five transmembrane peptide helices to hold a pseudo-symmetric double set of redox components. Two molecules of PscD are housed within a subunit. PscD may be involved in stabilising the PscB component since it is found to co-precipitate with FMO (Fenna-Mathews-Olson BChl a-protein) and PscB. It may also be involved in the interaction with ferredoxin []. 
Probab=49.48  E-value=17  Score=27.48  Aligned_cols=30  Identities=33%  Similarity=0.575  Sum_probs=25.4

Q ss_pred             CCCeecCCCCEEEEeecCCCCC-ceEEEecC
Q 031740           37 HGNTVQPNCQYYLVSAIPGAGG-IKLALSPY   66 (153)
Q Consensus        37 ~G~~l~~g~~YyI~pa~~g~GG-lPV~Fs~~   66 (153)
                      .||++--..+|||-.|.|+.-| |-+.|+|.
T Consensus        24 sGNa~HK~eKYfITsAkRD~~g~Lql~i~pa   54 (144)
T PF10657_consen   24 SGNAVHKAEKYFITSAKRDRYGKLQLTISPA   54 (144)
T ss_pred             cCchhhhhheeEEeeeecccCCceEEEEecC
Confidence            7999999999999999998755 77777664


No 10 
>PF03831 PhnA:  PhnA protein;  InterPro: IPR013988 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the C-terminal domain of PhnA.; PDB: 2AKK_A 2AKL_A.
Probab=49.36  E-value=8.1  Score=25.18  Aligned_cols=19  Identities=26%  Similarity=0.303  Sum_probs=10.9

Q ss_pred             ceeeCCCCeecCCCCEEEE
Q 031740           32 PLFDVHGNTVQPNCQYYLV   50 (153)
Q Consensus        32 ~VlD~~G~~l~~g~~YyI~   50 (153)
                      .|.|.+|++|+.|-+--++
T Consensus         1 vv~DsnGn~L~dGDsV~~i   19 (56)
T PF03831_consen    1 VVKDSNGNELQDGDSVTLI   19 (56)
T ss_dssp             S-B-TTS-B--TTEEEEES
T ss_pred             CeEcCCCCCccCCCEEEEE
Confidence            3789999999999776654


No 11 
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism]
Probab=47.02  E-value=20  Score=26.41  Aligned_cols=22  Identities=18%  Similarity=0.143  Sum_probs=18.9

Q ss_pred             CceeeCCCCeecCCCCEEEEee
Q 031740           31 EPLFDVHGNTVQPNCQYYLVSA   52 (153)
Q Consensus        31 ~~VlD~~G~~l~~g~~YyI~pa   52 (153)
                      ..|.|.+||.|+.|..--|+-.
T Consensus        43 ~~v~DsnGn~L~dGDsV~lIKD   64 (112)
T COG2824          43 LIVKDSNGNLLADGDSVTLIKD   64 (112)
T ss_pred             eEEEcCCCcEeccCCeEEEEEe
Confidence            5899999999999988777654


No 12 
>COG5510 Predicted small secreted protein [Function unknown]
Probab=46.12  E-value=16  Score=22.61  Aligned_cols=17  Identities=18%  Similarity=0.211  Sum_probs=10.0

Q ss_pred             CCCchhHHHHHHHHHHH
Q 031740            1 MKTPLPTTFFFLILTLA   17 (153)
Q Consensus         1 MK~~~~~~lsfll~a~t   17 (153)
                      ||.+.++.+++++.++.
T Consensus         2 mk~t~l~i~~vll~s~l   18 (44)
T COG5510           2 MKKTILLIALVLLASTL   18 (44)
T ss_pred             chHHHHHHHHHHHHHHH
Confidence            77776665545555543


No 13 
>PRK10220 hypothetical protein; Provisional
Probab=44.85  E-value=24  Score=26.05  Aligned_cols=22  Identities=18%  Similarity=0.146  Sum_probs=18.4

Q ss_pred             CceeeCCCCeecCCCCEEEEee
Q 031740           31 EPLFDVHGNTVQPNCQYYLVSA   52 (153)
Q Consensus        31 ~~VlD~~G~~l~~g~~YyI~pa   52 (153)
                      ..|.|++|++|..|-+--++=.
T Consensus        42 ~~vkDsnG~~L~dGDsV~viKD   63 (111)
T PRK10220         42 LIVKDANGNLLADGDSVTIVKD   63 (111)
T ss_pred             ceEEcCCCCCccCCCEEEEEee
Confidence            4799999999999988777654


No 14 
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=44.27  E-value=24  Score=25.98  Aligned_cols=22  Identities=18%  Similarity=0.173  Sum_probs=18.4

Q ss_pred             CceeeCCCCeecCCCCEEEEee
Q 031740           31 EPLFDVHGNTVQPNCQYYLVSA   52 (153)
Q Consensus        31 ~~VlD~~G~~l~~g~~YyI~pa   52 (153)
                      ..|.|.+|++|+.|-+=-++=.
T Consensus        41 ~~~kDsnG~~L~dGDsV~liKD   62 (109)
T TIGR00686        41 LIVKDCNGNLLANGDSVILIKD   62 (109)
T ss_pred             ceEEcCCCCCccCCCEEEEEee
Confidence            4699999999999988777654


No 15 
>TIGR02588 conserved hypothetical protein TIGR02588. The function of this protein is unknown. It is always found as part of a two-gene operon with TIGR02587, a protein that appears to span the membrane seven times. It is found in Nostoc sp. PCC 7120, Agrobacterium tumefaciens, Sinorhizobium meliloti, and Gloeobacter violaceus, so far, all of which are bacterial.
Probab=41.36  E-value=1.4e+02  Score=22.30  Aligned_cols=57  Identities=16%  Similarity=0.157  Sum_probs=39.2

Q ss_pred             CCCceeeCCCCeecCCCCEEEEeecCCCCC---ceEEEec-CCCCceeecCCceEEEeccC
Q 031740           29 FPEPLFDVHGNTVQPNCQYYLVSAIPGAGG---IKLALSP-YENSTIVRESTDLNLIFPVL   85 (153)
Q Consensus        29 ~~~~VlD~~G~~l~~g~~YyI~pa~~g~GG---lPV~Fs~-~~~~~~I~e~t~lnI~F~~~   85 (153)
                      .|....+..+..=+.+++||+--.+++.||   --|...- ....+-+.|.-...|.|-..
T Consensus        33 pp~l~v~~~~~~r~~~gqyyVpF~V~N~gg~TAasV~V~geL~~~~~v~E~~e~tiDfl~g   93 (122)
T TIGR02588        33 AAVLEVAPAEVERMQTGQYYVPFAIHNLGGTTAAAVNIRGELRQAGAVVENAEVTIDYLAS   93 (122)
T ss_pred             CCeEEEeehheeEEeCCEEEEEEEEEeCCCcEEEEEEEEEEEccCCceeEEeeEEEEEcCC
Confidence            344555666665558889999999999988   3444432 22344578888899999755


No 16 
>PF08194 DIM:  DIM protein;  InterPro: IPR013172 Drosophila immune-induced molecules (DIMs) are short proteins induced during the immune response of Drosophila []. This entry includes DIMs 1 to 4 and DIM23.
Probab=39.58  E-value=47  Score=19.73  Aligned_cols=16  Identities=38%  Similarity=0.339  Sum_probs=9.0

Q ss_pred             CCCchhHHHHHHHHHHH
Q 031740            1 MKTPLPTTFFFLILTLA   17 (153)
Q Consensus         1 MK~~~~~~lsfll~a~t   17 (153)
                      ||...+.++ ++|+|+.
T Consensus         1 Mk~l~~a~~-l~lLal~   16 (36)
T PF08194_consen    1 MKCLSLAFA-LLLLALA   16 (36)
T ss_pred             CceeHHHHH-HHHHHHH
Confidence            888766322 4555543


No 17 
>PF09466 Yqai:  Hypothetical protein Yqai;  InterPro: IPR018474 The hypothetical protein YqaI is expressed in bacteria, particularly Bacillus subtilis. It forms a homo-dimer, with each monomer containing an alpha helix and four beta strands.; PDB: 2DSM_B.
Probab=38.41  E-value=24  Score=24.01  Aligned_cols=20  Identities=25%  Similarity=0.652  Sum_probs=12.1

Q ss_pred             ceeeCCCCeecCCCCEEEEe
Q 031740           32 PLFDVHGNTVQPNCQYYLVS   51 (153)
Q Consensus        32 ~VlD~~G~~l~~g~~YyI~p   51 (153)
                      ++.|.-|+++.+|.+|++.|
T Consensus        25 ~i~D~yG~EI~~~D~y~i~~   44 (71)
T PF09466_consen   25 PIEDFYGDEIFPGDDYFISP   44 (71)
T ss_dssp             B---TTSS-B-TTS-EEE-E
T ss_pred             ceeeeeccccccCCeEEEeC
Confidence            67789999999999999965


No 18 
>COG1999 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems [General function prediction only]
Probab=35.85  E-value=13  Score=29.75  Aligned_cols=9  Identities=44%  Similarity=1.442  Sum_probs=7.3

Q ss_pred             EEecCCCcC
Q 031740          144 IVHCPSICE  152 (153)
Q Consensus       144 LvfCp~vc~  152 (153)
                      ..+||.|||
T Consensus        76 yT~CpdVCP   84 (207)
T COG1999          76 YTHCPDVCP   84 (207)
T ss_pred             cCCCCccCh
Confidence            467999997


No 19 
>COG5402 Uncharacterized conserved protein [Function unknown]
Probab=35.70  E-value=1.6e+02  Score=23.55  Aligned_cols=28  Identities=21%  Similarity=0.422  Sum_probs=23.1

Q ss_pred             eeeCCCCeecCCCCEEEEeecCCCCC-ceEEEecC
Q 031740           33 LFDVHGNTVQPNCQYYLVSAIPGAGG-IKLALSPY   66 (153)
Q Consensus        33 VlD~~G~~l~~g~~YyI~pa~~g~GG-lPV~Fs~~   66 (153)
                      -.|..|++|+.+-+|-|-      || -|.+|...
T Consensus        79 ~~Ds~g~~Lr~~C~Yri~------G~~ppARfWTl  107 (194)
T COG5402          79 TTDSAGQRLRRECSYRIE------GGTPPARFWTL  107 (194)
T ss_pred             eecCCCchhhccCcEEec------CCCCCceeEEE
Confidence            359999999999999874      66 68899763


No 20 
>PF15284 PAGK:  Phage-encoded virulence factor
Probab=34.10  E-value=28  Score=23.04  Aligned_cols=17  Identities=18%  Similarity=0.370  Sum_probs=8.5

Q ss_pred             CCC--chhHHHHHHHHHHH
Q 031740            1 MKT--PLPTTFFFLILTLA   17 (153)
Q Consensus         1 MK~--~~~~~lsfll~a~t   17 (153)
                      ||.  ..++.|.|.|.|.+
T Consensus         1 Mkk~ksifL~l~~~LsA~~   19 (61)
T PF15284_consen    1 MKKFKSIFLALVFILSAAG   19 (61)
T ss_pred             ChHHHHHHHHHHHHHHHhh
Confidence            773  33444445555544


No 21 
>KOG3352 consensus Cytochrome c oxidase, subunit Vb/COX4 [Energy production and conversion]
Probab=33.53  E-value=53  Score=25.55  Aligned_cols=36  Identities=25%  Similarity=0.167  Sum_probs=25.2

Q ss_pred             ceEEEeCCccCCCCCCCCCCcEEEEEeCCC-----CCCcEEEecC
Q 031740          109 IWFVTTGGFVGYPGAETLLNWFKLEKFGTF-----PGAYKIVHCP  148 (153)
Q Consensus       109 ~~~V~tGg~~g~pg~~t~~~~FkIek~~~~-----~~~YKLvfCp  148 (153)
                      .+.|.-|..+++    +.-.||.|||-+..     +..|||+.=+
T Consensus       109 ~RiVGC~c~eD~----~~V~Wmwl~Kge~~rc~eCG~~fkL~~v~  149 (153)
T KOG3352|consen  109 KRIVGCGCEEDS----HAVVWMWLEKGETQRCPECGHYFKLVPVG  149 (153)
T ss_pred             ceEEeecccCCC----cceEEEEEEcCCcccCCcccceEEeeecC
Confidence            567777665553    34589999998753     4679998643


No 22 
>PLN03207 stomagen; Provisional
Probab=33.35  E-value=46  Score=24.28  Aligned_cols=12  Identities=42%  Similarity=0.653  Sum_probs=5.5

Q ss_pred             hHHHHHHHHHHH
Q 031740            6 PTTFFFLILTLA   17 (153)
Q Consensus         6 ~~~lsfll~a~t   17 (153)
                      .+.|+||||+|.
T Consensus        12 ~~~lffLl~~ll   23 (113)
T PLN03207         12 CLTLFFLLFFLL   23 (113)
T ss_pred             hHHHHHHHHHHH
Confidence            444445555443


No 23 
>PF15240 Pro-rich:  Proline-rich
Probab=33.08  E-value=36  Score=27.10  Aligned_cols=13  Identities=23%  Similarity=0.283  Sum_probs=7.2

Q ss_pred             hhHHHHHHHHHHH
Q 031740            5 LPTTFFFLILTLA   17 (153)
Q Consensus         5 ~~~~lsfll~a~t   17 (153)
                      ||++|+..||||+
T Consensus         2 LlVLLSvALLALS   14 (179)
T PF15240_consen    2 LLVLLSVALLALS   14 (179)
T ss_pred             hhHHHHHHHHHhh
Confidence            3444556666664


No 24 
>PF10813 DUF2733:  Protein of unknown function (DUF2733);  InterPro: IPR024360 The UL11 gene product of herpes simplex virus is a membrane-associated tegument protein that is incorporated into the HSV virion and functions in viral envelopment []. UL11 is acylated, which is crucial for lipid raft association [].
Probab=32.89  E-value=25  Score=20.38  Aligned_cols=19  Identities=32%  Similarity=0.482  Sum_probs=14.3

Q ss_pred             CCCceeeCCCCeecCCCCE
Q 031740           29 FPEPLFDVHGNTVQPNCQY   47 (153)
Q Consensus        29 ~~~~VlD~~G~~l~~g~~Y   47 (153)
                      ..+++.|.+|+++.--.+|
T Consensus        11 r~n~l~Dv~G~~Inl~~dF   29 (32)
T PF10813_consen   11 RHNPLKDVKGNPINLYKDF   29 (32)
T ss_pred             cCCcccccCCCEEechhcc
Confidence            3468999999998755444


No 25 
>KOG3858 consensus Ephrin, ligand for Eph receptor tyrosine kinase [Signal transduction mechanisms]
Probab=32.20  E-value=33  Score=28.40  Aligned_cols=21  Identities=33%  Similarity=0.561  Sum_probs=17.9

Q ss_pred             CCCCeecCCCCEEEEeecCCC
Q 031740           36 VHGNTVQPNCQYYLVSAIPGA   56 (153)
Q Consensus        36 ~~G~~l~~g~~YyI~pa~~g~   56 (153)
                      ..|.+-++|.+||+++...|.
T Consensus       116 p~G~EF~pG~~YY~IStStg~  136 (233)
T KOG3858|consen  116 PLGFEFQPGHTYYYISTSTGD  136 (233)
T ss_pred             CCCccccCCCeEEEEeCCCcc
Confidence            369999999999999987654


No 26 
>PF15165 REC114-like:  Meiotic recombination protein REC114-like
Probab=32.14  E-value=70  Score=26.67  Aligned_cols=21  Identities=33%  Similarity=0.463  Sum_probs=15.2

Q ss_pred             CCCcEEEeccCCCCcceEEEe
Q 031740           94 KQSLWKVDNYNASSGIWFVTT  114 (153)
Q Consensus        94 ~st~W~v~~~~~~~~~~~V~t  114 (153)
                      .|+.|||.+.+++.+...+++
T Consensus        27 ~s~~wkv~es~ee~~~lvlti   47 (243)
T PF15165_consen   27 SSPSWKVFESNEESGYLVLTI   47 (243)
T ss_pred             CCccceeecccccCCceEEEE
Confidence            478999998777776655444


No 27 
>PF00879 Defensin_propep:  Defensin propeptide The pattern for this Prosite entry doesn't match the propeptide.;  InterPro: IPR002366 Defensins are 2-6 kDa, cationic, microbicidal peptides active against many Gram-negative and Gram-positive bacteria, fungi, and enveloped viruses [], containing three pairs of intramolecular disulphide bonds []. On the basis of their size and pattern of disulphide bonding, mammalian defensins are classified into alpha, beta and theta categories. Alpha-defensins, which have been identified in humans, monkeys and several rodent species, are particularly abundant in neutrophils, certain macrophage populations and Paneth cells of the small intestine. Every mammalian species explored thus far has beta-defensins. In cows, as many as 13 beta-defensins exist in neutrophils. However, in other species, beta-defensins are more often produced by epithelial cells lining various organs (e.g. the epidermis, bronchial tree and genitourinary tract). Theta-defensins are cyclic and have so far only been identified in primate phagocytes.   Defensins are produced constitutively and/or in response to microbial products or proinflammatory cytokines. Some defensins are also called corticostatins (CS) because they inhibit corticotropin-stimulated corticosteroid production. The mechanism(s) by which microorganisms are killed and/or inactivated by defensins is not understood completely. However, it is generally believed that killing is a consequence of disruption of the microbial membrane. The polar topology of defensins, with spatially separated charged and hydrophobic regions, allows them to insert themselves into the phospholipid membranes so that their hydrophobic regions are buried within the lipid membrane interior and their charged (mostly cationic) regions interact with anionic phospholipid head groups and water. Subsequently, some defensins can aggregate to form `channel-like' pores; others might bind to and cover the microbial membrane in a `carpet-like' manner. The net outcome is the disruption of membrane integrity and function, which ultimately leads to the lysis of microorganisms. Some defensins are synthesized as propeptides which may be relevant to this process - in neutrophils only the mature peptides have been identified but in Paneth cells, the propeptide is stored in vesicles [] and appears to be cleaved by trypsin on activation.  ; GO: 0006952 defense response
Probab=31.93  E-value=48  Score=21.22  Aligned_cols=18  Identities=28%  Similarity=0.357  Sum_probs=12.1

Q ss_pred             CCCchhHHHHHHHHHHHhh
Q 031740            1 MKTPLPTTFFFLILTLATN   19 (153)
Q Consensus         1 MK~~~~~~lsfll~a~tt~   19 (153)
                      ||+..|++- .||+||-..
T Consensus         1 MRTL~LLaA-lLLlAlqaQ   18 (52)
T PF00879_consen    1 MRTLALLAA-LLLLALQAQ   18 (52)
T ss_pred             CcHHHHHHH-HHHHHHHHh
Confidence            887766644 677777644


No 28 
>KOG2792 consensus Putative cytochrome C oxidase assembly protein [Energy production and conversion]
Probab=30.63  E-value=33  Score=29.10  Aligned_cols=9  Identities=56%  Similarity=1.538  Sum_probs=7.7

Q ss_pred             EEecCCCcC
Q 031740          144 IVHCPSICE  152 (153)
Q Consensus       144 LvfCp~vc~  152 (153)
                      +.+||.+||
T Consensus       148 FThCPDICP  156 (280)
T KOG2792|consen  148 FTHCPDICP  156 (280)
T ss_pred             ccCCCCcCh
Confidence            567999998


No 29 
>PF05550 Peptidase_C53:  Pestivirus Npro endopeptidase C53;  InterPro: IPR008751 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to MEROPS peptidase family C53 (clan C-). The active site residues occur in the order E, H, C in the sequence which is unlike that in any other family. They are unique to pestiviruses. The N-terminal cysteine peptidase (Npro) encoded by the bovine viral diarrhoea virus genome is responsible for the self-cleavage that releases the N terminus of the core protein. This unique protease is dispensable for viral replication, and its coding region can be replaced by a ubiquitin gene directly fused in frame to the core [, , , ].; GO: 0016032 viral reproduction, 0019082 viral protein processing
Probab=30.61  E-value=31  Score=26.87  Aligned_cols=17  Identities=29%  Similarity=0.589  Sum_probs=14.3

Q ss_pred             CCCCceeeCCCCeecCC
Q 031740           28 SFPEPLFDVHGNTVQPN   44 (153)
Q Consensus        28 a~~~~VlD~~G~~l~~g   44 (153)
                      ...|||+|..|+||.-.
T Consensus        19 Gv~EPVyd~~g~plfGe   35 (168)
T PF05550_consen   19 GVEEPVYDSAGNPLFGE   35 (168)
T ss_pred             ccccccccCCCCCccCC
Confidence            45589999999999865


No 30 
>PRK13701 psiB plasmid SOS inhibition protein B; Provisional
Probab=28.98  E-value=85  Score=24.14  Aligned_cols=11  Identities=18%  Similarity=0.776  Sum_probs=8.6

Q ss_pred             ccCC---CCcEEEe
Q 031740           91 YCNK---QSLWKVD  101 (153)
Q Consensus        91 ~C~~---st~W~v~  101 (153)
                      .|..   |+.|.++
T Consensus        77 vCSpG~~sP~W~~V   90 (144)
T PRK13701         77 LCSPGDVSPVWVLV   90 (144)
T ss_pred             EeCCCCCCcceEEE
Confidence            4764   8999998


No 31 
>PRK10159 outer membrane phosphoporin protein E; Provisional
Probab=28.69  E-value=55  Score=27.99  Aligned_cols=17  Identities=12%  Similarity=0.257  Sum_probs=12.4

Q ss_pred             CCCceeeCCCCeecCCC
Q 031740           29 FPEPLFDVHGNTVQPNC   45 (153)
Q Consensus        29 ~~~~VlD~~G~~l~~g~   45 (153)
                      .+.+|+|.||.-|.-.+
T Consensus        20 ~A~~vy~~d~ssvtlyG   36 (351)
T PRK10159         20 QAAEVYNKDGNKLDVYG   36 (351)
T ss_pred             cEEEEEECCCCEEEEEE
Confidence            33589999998777554


No 32 
>PRK01904 hypothetical protein; Provisional
Probab=27.57  E-value=3.1e+02  Score=22.06  Aligned_cols=12  Identities=8%  Similarity=0.379  Sum_probs=8.8

Q ss_pred             ceeeCCCCeecC
Q 031740           32 PLFDVHGNTVQP   43 (153)
Q Consensus        32 ~VlD~~G~~l~~   43 (153)
                      .++=.||+.+..
T Consensus        31 ~lL~vnG~kv~~   42 (219)
T PRK01904         31 DFLAIDGQKASK   42 (219)
T ss_pred             EEEEECCEECcc
Confidence            567788888764


No 33 
>PF07951 Toxin_R_bind_C:  Clostridium neurotoxin, C-terminal receptor binding;  InterPro: IPR013104 The Clostridium neurotoxin family is composed of tetanus neurotoxins and seven serotypes of botulinum neurotoxin. The structure of the botulinum neurotoxin reveals a four domain protein. The N-terminal catalytic domain (IPR000395 from INTERPRO), the central translocation domains and two receptor-binding domains []. This domain is the C-terminal receptor-binding domain, which adopts a modified beta-trefoil fold with a six stranded beta-barrel and a beta-hairpin triplet capping the domain []. The first step in the intoxication process is a binding event between this domain and the pre-synaptic nerve ending []. ; PDB: 3AZW_A 3N7L_A 3AZV_A 3N7M_A 3RSJ_B 3FUQ_A 3RMX_D 3OBT_A 3RMY_B 3OGG_A ....
Probab=27.06  E-value=61  Score=26.55  Aligned_cols=99  Identities=14%  Similarity=0.216  Sum_probs=56.9

Q ss_pred             CCceeeCCCCeecCCCCEEEEeecCCC-------C-------------------------CceEEEecC----CCCceee
Q 031740           30 PEPLFDVHGNTVQPNCQYYLVSAIPGA-------G-------------------------GIKLALSPY----ENSTIVR   73 (153)
Q Consensus        30 ~~~VlD~~G~~l~~g~~YyI~pa~~g~-------G-------------------------GlPV~Fs~~----~~~~~I~   73 (153)
                      ...+.|==||||+-..+||++++..-.       .                         |++|++-..    +.+..||
T Consensus         7 ~niLKDfWGN~L~YdkeYYl~N~~~~n~yi~~~~~~~~~~n~~r~~~~~ni~~n~r~LY~G~k~iIkr~~~~~~~Dn~Vr   86 (214)
T PF07951_consen    7 TNILKDFWGNYLRYDKEYYLLNVLYPNKYIKRKSDSILSINNQRGTGVFNIYLNYRDLYTGIKFIIKRYADNSNNDNRVR   86 (214)
T ss_dssp             TTB-BBTTSSB-BTTSEEEEEESSSTTEEEEEETTSEEEEEEEEEEEEEEEESEETSSSSS-EEEEEESSTSSSTSSB-B
T ss_pred             ccHHHHhcCCccccCceeEEEecCCcccceeecccceeeecccccccceeeeeeehhhccCceEEEEEccCCCCCcceee
Confidence            458899999999999999999875411       1                         156665432    2678999


Q ss_pred             cCCceEEEeccCCCCCcccCCCCcEEEecc-----CCCCcceEEEeCCccCCCCCCCCCCcEEEEEeCC
Q 031740           74 ESTDLNLIFPVLLSGREYCNKQSLWKVDNY-----NASSGIWFVTTGGFVGYPGAETLLNWFKLEKFGT  137 (153)
Q Consensus        74 e~t~lnI~F~~~~~~~~~C~~st~W~v~~~-----~~~~~~~~V~tGg~~g~pg~~t~~~~FkIek~~~  137 (153)
                      .+..+-|.|...         ...|+|-..     +.+..+-++-+.+....-+.-..-.-|+|++..+
T Consensus        87 ~~D~iy~n~~~~---------n~ey~l~~~~~Y~~~~~~~~kli~l~~l~~~~~~~~~~~vmqik~~~~  146 (214)
T PF07951_consen   87 NGDYIYFNVVIN---------NKEYRLYADTMYKNSKNQSEKLIYLLRLSDSNDNINQYIVMQIKNYNS  146 (214)
T ss_dssp             TTEEEEEEEEET---------TEEEEEEEETEECTTSSSSEEEEEEEEEECSCTTTCEECEEEEEEEEE
T ss_pred             cCCEEEEEEEeC---------CceEEEEeeeecccccccchheeeEEecccCCCCcCceEEEEEEeccc
Confidence            999998888654         346887210     1222334453333211100111235799999864


No 34 
>PF00812 Ephrin:  Ephrin;  InterPro: IPR001799 Ephrins are a family of proteins [] that are ligands of class V (EPH-related) receptor protein-tyrosine kinases (see IPR001426 from INTERPRO). These receptors and their ligands have been implicated in regulating neuronal axon guidance and in patterning of the developing nervous system and may also serve a patterning and compartmentalisation role outside of the nervous system as well. Ephrins are membrane-attached proteins of 205 to 340 residues. Attachment appears to be crucial for their normal function. Type-A ephrins are linked to the membrane via a glycosylphosphatidylinositol (GPI)-linkage, while type-B ephrins are type-I membrane proteins.; GO: 0016020 membrane; PDB: 3HEI_P 3CZU_B 3MBW_B 1KGY_E 1IKO_P 2WO3_B 2I85_A 2VSK_B 3GXU_B 2VSM_B ....
Probab=26.80  E-value=45  Score=25.52  Aligned_cols=20  Identities=35%  Similarity=0.650  Sum_probs=15.6

Q ss_pred             CCCeecCCCCEEEEeecCCC
Q 031740           37 HGNTVQPNCQYYLVSAIPGA   56 (153)
Q Consensus        37 ~G~~l~~g~~YyI~pa~~g~   56 (153)
                      .|-+-++|.+||++....|.
T Consensus       101 ~G~EF~pG~~YY~ISts~g~  120 (145)
T PF00812_consen  101 LGLEFQPGHDYYYISTSTGT  120 (145)
T ss_dssp             TSSS--TTEEEEEEEEESSS
T ss_pred             CCeeecCCCeEEEEEccCCC
Confidence            79999999999999987654


No 35 
>PRK11289 ampC beta-lactamase/D-alanine carboxypeptidase; Provisional
Probab=26.05  E-value=35  Score=29.65  Aligned_cols=15  Identities=40%  Similarity=0.319  Sum_probs=9.9

Q ss_pred             CCCchhHHHHHHHHH
Q 031740            1 MKTPLPTTFFFLILT   15 (153)
Q Consensus         1 MK~~~~~~lsfll~a   15 (153)
                      ||..+++++.+|+++
T Consensus         2 ~~~~~~~~~~~~~~~   16 (384)
T PRK11289          2 MKMMLLLLLAALLLT   16 (384)
T ss_pred             cchhhHHHHHHHHHH
Confidence            888887766444444


No 36 
>PHA02283 hypothetical protein
Probab=24.87  E-value=71  Score=25.73  Aligned_cols=18  Identities=17%  Similarity=0.279  Sum_probs=14.4

Q ss_pred             ecCCCCEEEEeecCCCCC
Q 031740           41 VQPNCQYYLVSAIPGAGG   58 (153)
Q Consensus        41 l~~g~~YyI~pa~~g~GG   58 (153)
                      .+.|.+|||-|+.+..+|
T Consensus        44 ~kkg~ey~IYPv~~d~~~   61 (210)
T PHA02283         44 VSEGEELFLYPVQTDGKG   61 (210)
T ss_pred             EecccceEEEEEEEcCCc
Confidence            456788999999888776


No 37 
>PF13209 DUF4017:  Protein of unknown function (DUF4017)
Probab=22.91  E-value=77  Score=20.67  Aligned_cols=40  Identities=18%  Similarity=0.299  Sum_probs=22.7

Q ss_pred             CCCchhHHHHHHHHHHHhhhccccCCCCCCCceeeCCCCeecCCCCE
Q 031740            1 MKTPLPTTFFFLILTLATNYLLVLGTTSFPEPLFDVHGNTVQPNCQY   47 (153)
Q Consensus         1 MK~~~~~~lsfll~a~tt~~l~~~~~~a~~~~VlD~~G~~l~~g~~Y   47 (153)
                      ||+.+...+..+......-.+|+|       .=+.+-|=.|.-|.-|
T Consensus         1 MKni~paL~~Y~IVCiiaii~PaS-------egYN~vgWKlfvGQ~Y   40 (60)
T PF13209_consen    1 MKNIIPALLVYIIVCIIAIILPAS-------EGYNTVGWKLFVGQAY   40 (60)
T ss_pred             CCcchHHHHHHHHHHHHheeeecc-------cCccccchhheecchh
Confidence            898775444344444333344422       3466677777777665


No 38 
>PF12262 Lipase_bact_N:  Bacterial virulence factor lipase N-terminal
Probab=22.80  E-value=30  Score=29.04  Aligned_cols=26  Identities=19%  Similarity=0.411  Sum_probs=12.2

Q ss_pred             eecCCCCEEEEee--cCCCCCceEEEec
Q 031740           40 TVQPNCQYYLVSA--IPGAGGIKLALSP   65 (153)
Q Consensus        40 ~l~~g~~YyI~pa--~~g~GGlPV~Fs~   65 (153)
                      ||.++.+|+++--  +.+.-|-||.=++
T Consensus       161 PL~~~s~Y~~~vT~~i~Ds~G~pv~~S~  188 (268)
T PF12262_consen  161 PLKPSSSYIVAVTDGIKDSNGRPVGPSS  188 (268)
T ss_pred             cCCCCCccEEEEcccccccCCCCCCCCc
Confidence            3555655555432  2233445554443


No 39 
>COG0301 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzyme metabolism]
Probab=21.07  E-value=63  Score=28.66  Aligned_cols=22  Identities=23%  Similarity=0.498  Sum_probs=17.8

Q ss_pred             CeecCCCCEEEEeecCCCCCce
Q 031740           39 NTVQPNCQYYLVSAIPGAGGIK   60 (153)
Q Consensus        39 ~~l~~g~~YyI~pa~~g~GGlP   60 (153)
                      =+++...-|..-..+.|.||||
T Consensus       150 iEIr~~~ayi~~~~~~G~GGLP  171 (383)
T COG0301         150 IEIREDKAYIYTERIKGPGGLP  171 (383)
T ss_pred             EEEecCeEEEEEeeeccCCCCc
Confidence            3678888899988899999933


Done!