BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031757
         (153 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3BBN|M Chain M, Homology Model For The Spinach Chloroplast 30s Subunit
           Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
          Length = 145

 Score =  114 bits (285), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 81/119 (68%), Gaps = 10/119 (8%)

Query: 22  ISFHGLRVQGLRVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIGNKLTKELTGVE 81
           I   GL+++ +R+G  EIPN KR+E SLQ+++GIGRSR+ QIL DLN  NK+TK+L+  E
Sbjct: 37  IGHGGLQIECIRIGGVEIPNHKRVEYSLQYIHGIGRSRSRQILLDLNFDNKVTKDLSEEE 96

Query: 82  LNSLREEVSRYLTGEDLRRCIKNDVERLVDIQCYRGIRHSQGLPCRGQRTSTNARTRKG 140
           +  LR+E          +R  +  +ERL +I+CYRGIRH  GLP RGQRT  N RT KG
Sbjct: 97  VIILRKE----------KRFNRVAIERLKEIRCYRGIRHKLGLPVRGQRTKNNCRTLKG 145


>pdb|1FJG|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With The Antibiotics Streptomycin,
           Spectinomycin, And Paromomycin
 pdb|1HR0|M Chain M, Crystal Structure Of Initiation Factor If1 Bound To The
           30s Ribosomal Subunit
 pdb|1HNW|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With Tetracycline
 pdb|1HNX|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With Pactamycin
 pdb|1HNZ|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With Hygromycin B
 pdb|1GIX|P Chain P, Crystal Structure Of The Ribosome At 5.5 A Resolution.
           This File, 1gix, Contains The 30s Ribosome Subunit,
           Three Trna, And Mrna Molecules. 50s Ribosome Subunit Is
           In The File 1giy
 pdb|1IBK|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With The Antibiotic Paromomycin
 pdb|1IBL|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With A Messenger Rna Fragment And
           Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
           Site And With The Antibiotic Paromomycin
 pdb|1IBM|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In Complex With A Messenger Rna Fragment And
           Cognate Transfer Rna Anticodon Stem-Loop Bound At The A
           Site
 pdb|1JGO|P Chain P, The Path Of Messenger Rna Through The Ribosome. This File,
           1jgo, Contains The 30s Ribosome Subunit, Three Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
 pdb|1JGP|P Chain P, The Path Of Messenger Rna Through The Ribosome. This File,
           1jgp, Contains The 30s Ribosome Subunit, Three Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
 pdb|1JGQ|P Chain P, The Path Of Messenger Rna Through The Ribosome. This File,
           1jgq, Contains The 30s Ribosome Subunit, Three Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File 1giy
 pdb|1J5E|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit
 pdb|1MJ1|P Chain P, Fitting The Ternary Complex Of Ef-TuTRNAGTP AND RIBOSOMAL
           PROTEINS Into A 13 A Cryo-Em Map Of The Coli 70s
           Ribosome
 pdb|1N32|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Bound To Codon And Near-Cognate Transfer Rna
           Anticodon Stem-Loop Mismatched At The First Codon
           Position At The A Site With Paromomycin
 pdb|1N33|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Bound To Codon And Near-Cognate Transfer Rna
           Anticodon Stem-Loop Mismatched At The Second Codon
           Position At The A Site With Paromomycin
 pdb|1N34|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In The Presence Of Codon And
           Crystallographically Disordered Near-Cognate Transfer
           Rna Anticodon Stem-Loop Mismatched At The First Codon
           Position
 pdb|1N36|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit In The Presence Of Crystallographically
           Disordered Codon And Near-cognate Transfer Rna Anticodon
           Stem-loop Mismatched At The Second Codon Position
 pdb|1ML5|P Chain P, Structure Of The E. Coli Ribosomal Termination Complex
           With Release Factor 2
 pdb|1XMO|M Chain M, Crystal Structure Of Mnm5u34t6a37-Trnalysuuu Complexed
           With Aag-Mrna In The Decoding Center
 pdb|1XMQ|M Chain M, Crystal Structure Of T6a37-Asllysuuu Aaa-Mrna Bound To The
           Decoding Center
 pdb|1XNQ|M Chain M, Structure Of An Inosine-Adenine Wobble Base Pair Complex
           In The Context Of The Decoding Center
 pdb|1XNR|M Chain M, Crystal Structure Of An Inosine-Cytosine Wobble Base Pair
           In The Context Of The Decoding Center
 pdb|1YL4|P Chain P, Crystal Structure Of 70s Ribosome With Thrs Operator And
           Trnas. 30s Subunit. The Coordinates For The 50s Subunit
           Are In The Pdb Entry 1yl3
 pdb|2B64|M Chain M, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf1
           From A Crystal Structure Of The Whole Ribosomal Complex.
           This File Contains The 30s Subunit, Trnas, Mrna And
           Release Factor Rf1 From A Crystal Structure Of The Whole
           Ribosomal Complex". The Entire Crystal Structure
           Contains One 70s Ribosome, Trnas, Mrna And Release
           Factor Rf1 And Is Described In Remark 400.
 pdb|2B9M|M Chain M, 30s Ribosomal Subunit, Trnas, Mrna And Release Factor Rf2
           From A Crystal Structure Of The Whole Ribosomal Complex.
           This File Contains The 30s Ribosomal Subunit, Trnas,
           Mrna And Release Factor Rf2 From A Crystal Structure Of
           The Whole Ribosomal Complex". The Entire Crystal
           Structure Contains One 70s Ribosome, Trnas, Mrna And
           Release Factor Rf2 And Is Described In Remark 400.
 pdb|2B9O|M Chain M, 30s Ribosomal Subunit, Trnas And Mrna From A Crystal
           Structure Of The Whole Ribosomal Complex With A Stop
           Codon In The A-Site. This File Contains The 30s Subunit,
           Trnas And Mrna From A Crystal Structure Of The Whole
           Ribosomal Complex With A Stop Codon In The A-Site And Is
           Described In Remark 400.
 pdb|2F4V|M Chain M, 30s Ribosome + Designer Antibiotic
 pdb|2HHH|M Chain M, Crystal Structure Of Kasugamycin Bound To The 30s
           Ribosomal Subunit
 pdb|2J00|M Chain M, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 1 Of 4).
           This File Contains The 30s Subunit, Mrna, A-, P- And
           E-Site Trnas And Paromomycin For Molecule I.
 pdb|2J02|M Chain M, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Mrna, Trna And Paromomycin (Part 3 Of 4)
           This File Contains The 30s Subunit, Mrna, A-, P- And
           E-Site Trnas And Paromomycin For Molecule Ii.
 pdb|2HGI|P Chain P, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           Showing How The 16s 3'-End Mimicks Mrna E And P Codons.
           This Entry 2hgi Contains 30s Ribosomal Subunit. The 50s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgj.
 pdb|2HGP|P Chain P, Crystal Structure Of The 70s Thermus Thermophilus Ribosome
           With Translocated And Rotated Shine-Dalgarno Duplex.
           This Entry 2hgp Contains 30s Ribosomal Subunit. The 50s
           Ribosomal Subunit Can Be Found In Pdb Entry 2hgq.
 pdb|2HGR|P Chain P, 70s T.Th. Ribosome Functional Complex With Mrna And E- And
           P-Site Trnas At 4.5a. This Entry 2hgr Contains 30s
           Ribosomal Subunit. The 50s Ribosomal Subunit Can Be
           Found In Pdb Entry 2hgu.
 pdb|2OW8|NN Chain n, Crystal Structure Of A 70s Ribosome-Trna Complex Reveals
           Functional Interactions And Rearrangements. This File,
           2ow8, Contains The 30s Ribosome Subunit, Two Trna, And
           Mrna Molecules. 50s Ribosome Subunit Is In The File
           1vsa.
 pdb|2UU9|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Complexed With A Valine-asl With Cmo5u In
           Position 34 Bound To An Mrna With A Gug-codon In The
           A-site And Paromomycin.
 pdb|2UUA|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Complexed With A Valine-Asl With Cmo5u In
           Position 34 Bound To An Mrna With A Guc-Codon In The
           A-Site And Paromomycin.
 pdb|2UUB|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Complexed With A Valine-Asl With Cmo5u In
           Position 34 Bound To An Mrna With A Guu-Codon In The
           A-Site And Paromomycin.
 pdb|2UUC|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Complexed With A Valine-asl With Cmo5u In
           Position 34 Bound To An Mrna With A Gua-codon In The
           A-site And Paromomycin.
 pdb|2UXC|M Chain M, Crystal Structure Of An Extended Trna Anticodon Stem Loop
           In Complex With Its Cognate Mrna Ucgu In The Context Of
           The Thermus Thermophilus 30s Subunit.
 pdb|2UXB|M Chain M, Crystal Structure Of An Extended Trna Anticodon Stem Loop
           In Complex With Its Cognate Mrna Gggu In The Context Of
           The Thermus Thermophilus 30s Subunit.
 pdb|2V46|M Chain M, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 1 Of 4). This File Contains The 30s
           Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For
           Molecule 1.
 pdb|2V48|M Chain M, Structure Of The Ribosome Recycling Factor Bound To The
           Thermus Thermophilus 70s Ribosome With Mrna, Asl-Phe And
           Trna-Fmet (Part 3 Of 4). This File Contains The 30s
           Subunit, Mrna, P-Site Asl, E-Site Trna And Rrf For
           Molecule 2.
 pdb|2UXD|M Chain M, Crystal Structure Of An Extended Trna Anticodon Stem Loop
           In Complex With Its Cognate Mrna Cggg In The Context Of
           The Thermus Thermophilus 30s Subunit.
 pdb|2QNH|NN Chain n, Interactions And Dynamics Of The Shine-Dalgarno Helix In
           The 70s Ribosome. This File, 2qnh, Contains The 30s
           Ribosome Subunit, Two Trna, And Mrna Molecules. 50s
           Ribosome Subunit Is In The File 1vsp.
 pdb|2VQE|M Chain M, Modified Uridines With C5-methylene Substituents At The
           First Position Of The Trna Anticodon Stabilize U-g
           Wobble Pairing During Decoding
 pdb|2VQF|M Chain M, Modified Uridines With C5-Methylene Substituents At The
           First Position Of The Trna Anticodon Stabilize U-G
           Wobble Pairing During Decoding
 pdb|3D5A|M Chain M, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 30s Subunit, Release
           Factor 1 (Rf1), Two Trna, And Mrna Molecules Of One 70s
           Ribosome. The Entire Crystal Structure Contains Two 70s
           Ribosomes As Described In Remark 400.
 pdb|3D5C|M Chain M, Structural Basis For Translation Termination On The 70s
           Ribosome. This File Contains The 30s Subunit, Release
           Factor 1 (Rf1), Two Trna, And Mrna Molecules Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes As Described In Remark 400.
 pdb|3F1E|M Chain M, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           30s Subunit, Rf2, Two Trna, And Mrna Molecules Of One
           70s Ribosome. The Entire Crystal Structure Contains Two
           70s Ribosomes As Described In Remark 400.
 pdb|3F1G|M Chain M, Crystal Structure Of A Translation Termination Complex
           Formed With Release Factor Rf2. This File Contains The
           30s Subunit, Rf2, Two Trna, And Mrna Molecules Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes As Described In Remark 400.
 pdb|2WDG|M Chain M, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna.  This File
           Contains The 30s Subunit A-,P-, And E-Site Trnas And
           Paromomycin For Molecule I.
 pdb|2WDH|M Chain M, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A-Site Trna,
           Deacylated P-Site Trna, And E-Site Trna.  This File
           Contains The 30s Subunit A-,P-, And E-Site Trnas And
           Paromomycin For Molecule Ii.
 pdb|2WDK|M Chain M, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 30s
           Subunit A-,P-, And E-Site Trnas And Paromomycin For
           Molecule I.
 pdb|2WDM|M Chain M, Structure Of The Thermus Thermophilus 70s Ribosome In
           Complex With Mrna, Paromomycin, Acylated A- And P-Site
           Trnas, And E-Site Trna.  This File Contains The 30s
           Subunit A-,P-, And E-Site Trnas And Paromomycin For
           Molecule Ii.
 pdb|2WH1|M Chain M, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome
 pdb|2WH3|M Chain M, Insights Into Translational Termination From The Structure
           Of Rf2 Bound To The Ribosome). This File Contains The
           30s Subunit.
 pdb|3HUW|M Chain M, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 30s Subunit, Mrna, P-Site Trna And Ef-P For
           Molecule I.
 pdb|3HUY|M Chain M, Structure Of Ef-P Bound To The 70s Ribosome; This File
           Contains The 30s Subunit, Mrna, P-Site Trna And Ef-P For
           Molecule Ii.
 pdb|2WRI|M Chain M, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State (Part 1 Of 4).
 pdb|2WRK|M Chain M, The Structure Of The Ribosome With Elongation Factor G
           Trapped In The Post-Translocational State (Part 3 Of 4).
 pdb|2WRN|M Chain M, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 1 Of 4).
 pdb|2WRQ|M Chain M, The Crystal Structure Of The 70s Ribosome Bound To Ef-Tu
           And Trna (Part 3 Of 4).
 pdb|3KIQ|MM Chain m, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 1 Of 4)
 pdb|3KIS|MM Chain m, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Precleavage State; Part 3 Of 4)
 pdb|3KIU|MM Chain m, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 1 Of 4)
 pdb|3KIX|MM Chain m, Structure Of Rele Nuclease Bound To The 70s Ribosome
           (Postcleavage State; Part 3 Of 4)
 pdb|3KNH|M Chain M, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 30s Subunit For Molecule I
 pdb|3KNJ|M Chain M, The Structures Of Viomycin Bound To The 70s Ribosome. This
           File Contains The 30s Subunit For Molecule Ii'
 pdb|3KNL|M Chain M, The Structures Of Capreomycin Bound To The 70s Ribosome.
           This File Contains The 30s Subunit For Molecule I
 pdb|3KNN|M Chain M, The Structures Of Capreomycin Bound To The 70s Ribosome.
           This File Contains The 30s Subunit For Molecule Ii
 pdb|3I8G|P Chain P, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8g Contains 30s Ribosomal Subnit.The 50s
           Ribosomal Can Be Found In Pdb Entry 3i8f. Molecule B In
           The Same Asym Unit Is Deposited As 3i8g (30s) And 3i8f
           (50s).
 pdb|3I8H|P Chain P, Elongation Complex Of The 70s Ribosome With Three Trnas
           And Entry 3i8h Contains 30s Ribosomal Subnit. The 50s
           Ribosomal Can Be Found In Pdb Entry 3i8i. Molecule A In
           The Same Asym Unit Is Deposited As 3i8f (50s) And 3i8g
           (30s).
 pdb|3I9B|P Chain P, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9b Contains 30s Ribosomal Subunit Of Molecule B.
           The 50s Subunit Can Be Found In Pdb Entry 3i9c. Molecule
           A In The S Asymmetric Unit Is Deposited As 3i9d (30s)
           And 3i9e (50s)
 pdb|3I9D|P Chain P, Initiation Complex Of 70s Ribosome With Two Trnas And
           Mrna. 3i9d Contains 30s Ribosomal Subunit Of Molecule A.
           The 50s Subunit Can Be Found In Pdb Entry 3i9e. Molecule
           B In The S Asymmetric Unit Is Deposited As 3i9b (30s)
           And 3i9c (50s)
 pdb|2X9R|M Chain M, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 pdb|2X9T|M Chain M, Structure Of The 70s Ribosome Bound To Release Factor 2
           And A Substrate Analog Provides Insights Into Catalysis
           Of Peptide Release
 pdb|2XFZ|M Chain M, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 1 Of 4)
 pdb|2XG1|M Chain M, Structure Of Cytotoxic Domain Of Colicin E3 Bound To The
           70s Ribosome (Part 3 Of 4)
 pdb|3OTO|M Chain M, Crystal Structure Of The 30s Ribosomal Subunit From A Ksga
           Mutant Of Thermus Thermophilus (Hb8)
 pdb|3OGE|M Chain M, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Chloramphenicol. This File Contains The 30s Subunit
           Of One 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 pdb|3OGY|M Chain M, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Chloramphenicol. This File Contains The 30s Subunit
           Of One 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 pdb|3OHC|M Chain M, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 30s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 pdb|3OHD|M Chain M, Structure Of The Thermus Thermophilus Ribosome Complexed
           With Erythromycin. This File Contains The 30s Subunit Of
           One 70s Ribosome. The Entire Crystal Structure Contains
           Two 70s Ribosomes.
 pdb|3OHY|M Chain M, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 30s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OI0|M Chain M, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Azithromycin. This File Contains The 30s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OI2|M Chain M, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 30s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3OI4|M Chain M, Structure Of The Thermus Thermophilus 70s Ribosome
           Complexed With Telithromycin. This File Contains The 30s
           Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|2XQD|M Chain M, The Structure Of Ef-Tu And Aminoacyl-Trna Bound To The 70s
           Ribosome With A Gtp Analog
 pdb|2XSY|M Chain M, Trna Tranlocation On The 70s Ribosome: The Pre-
           Translocational Translocation Intermediate Ti(Pre)
 pdb|2XUY|M Chain M, Trna Translocation On The 70s Ribosome: The Post-
           Translocational Translocation Intermediate Ti(Post)
 pdb|2Y0U|M Chain M, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 pdb|2Y0W|M Chain M, The Crystal Structure Of Ef-Tu And A9c-Trna-Trp Bound To A
           Near-Cognate Codon On The 70s Ribosome
 pdb|2Y0Y|M Chain M, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y10|M Chain M, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 pdb|2Y12|M Chain M, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Near-Cognate Codon On The 70s Ribosome
 pdb|2Y14|M Chain M, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Cognate Codon On The 70s Ribosome.
 pdb|2Y16|M Chain M, The Crystal Structure Of Ef-Tu And G24a-Trna-Trp Bound To
           A Cognate Codon On The 70s Ribosome.
 pdb|2Y18|M Chain M, The Crystal Structure Of Ef-Tu And Trp-Trna-Trp Bound To A
           Cognate Codon On The 70s Ribosome.
 pdb|3ZVO|M Chain M, Crystal Structure Of The Hybrid State Of Ribosome In
           Complex With The Guanosine Triphosphatase Release Factor
           3
 pdb|3T1H|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Complexed With A Human Anti-Codon Stem Loop
           (Hasl) Of Transfer Rna Lysine 3 (Trnalys3) Bound To An
           Mrna With An Aaa-Codon In The A-Site And Paromomycin
 pdb|3T1Y|M Chain M, Structure Of The Thermus Thermophilus 30s Ribosomal
           Subunit Complexed With A Human Anti-Codon Stem Loop
           (Hasl) Of Transfer Rna Lysine 3 (Trnalys3) Bound To An
           Mrna With An Aag-Codon In The A-Site And Paromomycin
 pdb|3UXS|M Chain M, The Structure Of Thermorubin In Complex With The 70s
           Ribosome From Thermus Thermophilus. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|3UXT|M Chain M, The Structure Of Thermorubin In Complex With The 70s
           Ribosome From Thermus Thermophilus. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes.'
 pdb|3TVF|P Chain P, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 30s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Leu Complex
 pdb|3TVG|P Chain P, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 30s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Leu Complex
 pdb|3UYD|P Chain P, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 30s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex
 pdb|3UYF|P Chain P, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 30s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex
 pdb|3UZ3|P Chain P, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 30s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex With Paromomycin.
 pdb|3UZ4|P Chain P, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 30s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Leu Complex With Paromomycin.
 pdb|3UZ6|P Chain P, Structure Analysis Of Ribosomal Decoding. This Entry
           Contains The 30s Ribosomal Subunit Of The First 70s
           Molecule In The Asymmetric Unit For The Cognate Trna-Tyr
           Complex
 pdb|3UZ7|P Chain P, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 30s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Cognate
           Trna-Tyr Complex.
 pdb|3UZG|P Chain P, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 30s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Tyr Complex
 pdb|3UZI|P Chain P, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 30s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Tyr Complex
 pdb|3UZL|P Chain P, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 30s Ribosomal Subunit Of The First
           70s Molecule In The Asymmetric Unit For The Near-Cognate
           Trna-Tyr Complex With Paromomycin
 pdb|3UZM|P Chain P, Crystal Structure Analysis Of Ribosomal Decoding. This
           Entry Contains The 30s Ribosomal Subunit Of The Second
           70s Molecule In The Asymmetric Unit For The Near-cognate
           Trna-tyr Complex With Paromomycin
 pdb|4ABR|M Chain M, Complex Of Smpb, A Tmrna Fragment And Ef-Tu-Gdp-Kirromycin
           With The 70s Ribosome
 pdb|4DH9|M Chain M, Crystal Structure Of Yaej Bound To The 70s Ribosome
 pdb|4DHB|M Chain M, Crystal Structure Of Yaej Bound To The 70s Ribosome
 pdb|3V22|M Chain M, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 30s Subunit With
           Bound Rmf Of The 1st Ribosome In The Asu
 pdb|3V24|M Chain M, Crystal Structure Of Rmf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 30s Subunit With
           Bound Rmf Of The 2nd Ribosome In The Asu
 pdb|3V26|M Chain M, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 30s Subunit With
           Bound Hpf Of The 1st Ribosome In The Asu
 pdb|3V28|M Chain M, Crystal Structure Of Hpf Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 30s Subunit With
           Bound Hpf Of The 2nd Ribosome In The Asu
 pdb|3V2C|M Chain M, Crystal Structure Of Yfia Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 30s Subunit With
           Bound Yfia Of The 1st Ribosome In The Asu
 pdb|3V2E|M Chain M, Crystal Structure Of Yfia Bound To The 70s Ribosome. This
           Pdb Entry Contains Coordinates For The 30s Subunit With
           Bound Yfia Of The 2nd Ribosome In The Asu
 pdb|4AQY|M Chain M, Structure Of Ribosome-Apramycin Complexes
 pdb|4DR1|M Chain M, Crystal Structure Of The Apo 30s Ribosomal Subunit From
           Thermus Thermophilus (hb8)
 pdb|4DR2|M Chain M, Crystal Structure Of The Thermus Thermophilus (hb8) 30s
           Ribosomal Subunit With Multiple Copies Of Paromomycin
           Molecules Bound
 pdb|4DR3|M Chain M, Crystal Structure Of The Thermus Thermophilus (hb8) 30s
           Ribosomal Subunit With Streptomycin Bound
 pdb|4DR4|M Chain M, Crystal Structure Of The Thermus Thermophilus (hb8) 30s
           Ribosomal Subunit With Codon, Cognate Transfer Rna
           Anticodon Stem-loop And Multiple Copies Of Paromomycin
           Molecules Bound
 pdb|4DR5|M Chain M, Crystal Structure Of The Thermus Thermophilus (hb8) 30s
           Ribosomal Subunit With Codon, Crystallographically
           Disordered Cognate Transfer Rna Anticodon Stem-loop And
           Streptomycin Bound
 pdb|4DR6|M Chain M, Crystal Structure Of The Thermus Thermophilus (hb8) 30s
           Ribosomal Subunit With Codon, Near-cognate Transfer Rna
           Anticodon Stem-loop Mismatched At The First Codon
           Position And Streptomycin Bound
 pdb|4DR7|M Chain M, Crystal Structure Of The Thermus Thermophilus (hb8) 30s
           Ribosomal Subunit With Codon, Crystallographically
           Disordered Near-cognate Transfer Rna Anticodon Stem-loop
           Mismatched At The Second Codon Position, And
           Streptomycin Bound
 pdb|4G5K|P Chain P, Crystal Structure Of The 70s Ribosome With Tetracycline.
           This Entry Contains The 30s Subunit Of Molecule A.
 pdb|4G5M|P Chain P, Crystal Structure Of The 70s Ribosome With Tetracycline.
           This Entry Contains The 30s Subunit Of Molecule B.
 pdb|4G5T|P Chain P, Crystal Structure Of The 70s Ribosome With Tigecycline.
           This Entry Contains The 30s Subunit Of Molecule A.
 pdb|4G5V|P Chain P, Crystal Structure Of The 70s Ribosome With Tigecycline.
           This Entry Contains The 30s Subunit Of Molecule B.
 pdb|4DUY|M Chain M, Crystal Structure Of The Thermus Thermophilus 30s
           Ribosomal Subunit With A 16s Rrna Mutation, U13c
 pdb|4DUZ|M Chain M, Crystal Structure Of The Thermus Thermophilus 30s
           Ribosomal Subunit With A 16s Rrna Mutation, U13c, Bound
           With Streptomycin
 pdb|4DV0|M Chain M, Crystal Structure Of The Thermus Thermophilus 30s
           Ribosomal Subunit With A 16s Rrna Mutation, U20g
 pdb|4DV1|M Chain M, Crystal Structure Of The Thermus Thermophilus 30s
           Ribosomal Subunit With A 16s Rrna Mutation, U20g, Bound
           With Streptomycin
 pdb|4DV2|M Chain M, Crystal Structure Of The Thermus Thermophilus 30s
           Ribosomal Subunit With A 16s Rrna Mutation, C912a
 pdb|4DV3|M Chain M, Crystal Structure Of The Thermus Thermophilus 30s
           Ribosomal Subunit With A 16s Rrna Mutation, C912a, Bound
           With Streptomycin
 pdb|4DV4|M Chain M, Crystal Structure Of The Thermus Thermophilus 30s
           Ribosomal Subunit With A 16s Rrna Mutation, A914g
 pdb|4DV5|M Chain M, Crystal Structure Of The Thermus Thermophilus 30s
           Ribosomal Subunit With A 16s Rrna Mutation, A914g, Bound
           With Streptomycin
 pdb|4DV6|M Chain M, Crystal Structure Of The Thermus Thermophilus 30s
           Ribosomal Subunit With A 16s Rrna Mutation, A915g
 pdb|4DV7|M Chain M, Crystal Structure Of The Thermus Thermophilus 30s
           Ribosomal Subunit With A 16s Rrna Mutation, A915g, Bound
           With Streptomycin
          Length = 126

 Score =  107 bits (267), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 62/125 (49%), Positives = 83/125 (66%), Gaps = 6/125 (4%)

Query: 33  RVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIGNKLT--KELTGVELNSLREEV- 89
           R+   EIP +KR++ +L ++YGIG++RA + L    I N  T  K+LT  E+  LRE V 
Sbjct: 3   RIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGI-NPATRVKDLTEAEVVRLREYVE 61

Query: 90  -SRYLTGEDLRRCIKNDVERLVDIQCYRGIRHSQGLPCRGQRTSTNARTRKGKRVAIPGK 148
            +  L GE LR  +  +++RL+DI CYRG+RH +GLP RGQRT TNARTRKG R  + GK
Sbjct: 62  NTWKLEGE-LRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGK 120

Query: 149 KKPTR 153
           KK  R
Sbjct: 121 KKAPR 125


>pdb|1I94|M Chain M, Crystal Structures Of The Small Ribosomal Subunit With
           Tetracycline, Edeine And If3
 pdb|1I95|M Chain M, Crystal Structure Of The 30s Ribosomal Subunit From
           Thermus Thermophilus In Complex With Edeine
 pdb|1I96|M Chain M, Crystal Structure Of The 30s Ribosomal Subunit From
           Thermus Thermophilus In Complex With The Translation
           Initiation Factor If3 (C-Terminal Domain)
 pdb|1I97|M Chain M, Crystal Structure Of The 30s Ribosomal Subunit From
           Thermus Thermophilus In Complex With Tetracycline
 pdb|1PNS|M Chain M, Crystal Structure Of A Streptomycin Dependent Ribosome
           From E. Coli, 30s Subunit Of 70s Ribosome. This File,
           1pns, Contains The 30s Subunit, Two Trnas, And One Mrna
           Molecule. The 50s Ribosomal Subunit Is In File 1pnu.
 pdb|1PNX|M Chain M, Crystal Structure Of The Wild Type Ribosome From E. Coli,
           30s Subunit Of 70s Ribosome. This File, 1pnx, Contains
           Only Molecules Of The 30s Ribosomal Subunit. The 50s
           Subunit Is In The Pdb File 1pny.
 pdb|1VOQ|M Chain M, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 pdb|1VOS|M Chain M, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 pdb|1VOV|M Chain M, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 pdb|1VOX|M Chain M, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 pdb|1VOZ|M Chain M, Crystal Structure Of Five 70s Ribosomes From Escherichia
           Coli In Complex With Protein Y. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Five 70s Ribosomes And Is Described
           In Remark 400.
 pdb|2E5L|M Chain M, A Snapshot Of The 30s Ribosomal Subunit Capturing Mrna Via
           The Shine- Dalgarno Interaction
 pdb|2R1G|I Chain I, Coordinates Of The Thermus Thermophilus 30s Components
           Neighboring Rbfa As Obtained By Fitting Into The Cryo-em
           Map Of A 30s-rbfa Complex
 pdb|3FIC|M Chain M, T. Thermophilus 70s Ribosome In Complex With Mrna, Trnas
           And Ef- Tu.Gdp.Kirromycin Ternary Complex, Fitted To A
           6.4 A Cryo-Em Map. This File Contains The 30s Subunit
           And The Ligands
 pdb|2ZM6|M Chain M, Crystal Structure Of The Thermus Thermophilus 30s
           Ribosomal Subunit
          Length = 125

 Score =  107 bits (266), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 81/124 (65%), Gaps = 4/124 (3%)

Query: 33  RVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIGNKLT--KELTGVELNSLREEVS 90
           R+   EIP +KR++ +L ++YGIG++RA + L    I N  T  K+LT  E+  LRE V 
Sbjct: 2   RIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGI-NPATRVKDLTEAEVVRLREYVE 60

Query: 91  RYLTGE-DLRRCIKNDVERLVDIQCYRGIRHSQGLPCRGQRTSTNARTRKGKRVAIPGKK 149
                E +LR  +  +++RL+DI CYRG+RH +GLP RGQRT TNARTRKG R  + GKK
Sbjct: 61  NTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKK 120

Query: 150 KPTR 153
           K  R
Sbjct: 121 KAPR 124


>pdb|1VS5|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|1VS7|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|3E1A|F Chain F, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Pre- Accommodation State
 pdb|3E1C|F Chain F, Structure Of The 30s Subunit And The Trnas Of E. Coli
           Ribosome In Post-Accommodation State
 pdb|3I1M|M Chain M, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1O|M Chain M, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1Q|M Chain M, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1S|M Chain M, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1Z|M Chain M, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I21|M Chain M, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3KC4|M Chain M, Ribosome-Secy Complex. This Entry 3kc4 Contains 30s
           Ribosomal Subnit. The 50s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kcr
 pdb|3IYX|M Chain M, Coordinates Of The B1b Bridge-Forming Protein Structures
           Fitted Into The Cryo-Em Map Of E.Coli 70s Ribosome
           (Emd-1056)
 pdb|3IYY|M Chain M, Coordinates Of The B1b Bridge-Forming Protein Structures
           Fitted Into The Cryo-Em Map Of Efg.Gdpnp-Bound E.Coli
           70s Ribosome(Emd-1363)
 pdb|3OR9|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The First
           70s Ribosome.
 pdb|3ORA|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 pdb|3IZV|Q Chain Q, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon, AT-Site Trna, P-Site Trna, Mrna And
           Ef-Tu
 pdb|3IZW|Q Chain Q, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding.This Entry Contains The
           Small Subunit Of A Ribosome Programmed With A Cognate
           Codon, AT-Site Trna, P-Site Trna, Mrna And Ef-Tu
 pdb|3SFS|M Chain M, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
           State On A Rotated Conformation Of The Ribosome
 pdb|3UOQ|M Chain M, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
           State On A Rotated Conformation Of The Ribosome (Without
           Viomycin)
 pdb|4GAQ|M Chain M, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
 pdb|4GAS|M Chain M, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
          Length = 118

 Score =  103 bits (258), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 75/114 (65%), Gaps = 1/114 (0%)

Query: 33  RVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIGNKL-TKELTGVELNSLREEVSR 91
           R+    IP+ K    +L  +YG+G++R+  IL    I   +   EL+  ++++LR+EV++
Sbjct: 3   RIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAK 62

Query: 92  YLTGEDLRRCIKNDVERLVDIQCYRGIRHSQGLPCRGQRTSTNARTRKGKRVAI 145
           ++   DLRR I   ++RL+D+ CYRG+RH +GLP RGQRT TNARTRKG R  I
Sbjct: 63  FVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPI 116


>pdb|1P6G|M Chain M, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
           State Of E. Coli 70s Ribosome
 pdb|1P87|M Chain M, Real Space Refined Coordinates Of The 30s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The
           Initiation-Like State Of E. Coli 70s Ribosome
 pdb|2AVY|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2AW7|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 30s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes And Is
           Described In Remark 400.
 pdb|2I2P|M Chain M, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2I2U|M Chain M, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 30s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2QOU|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The First 70s Ribosome,
           With Spectinomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 pdb|2QOW|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 30s Subunit Of The Second 70s
           Ribosome, With Spectinomycin Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes.
 pdb|2QOY|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 pdb|2QP0|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome, With Spectinomycin And Neomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 pdb|2QAL|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Neomycin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QAN|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Neomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QB9|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Gentamicin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QBB|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Gentamicin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBD|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           First 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBF|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 30s Subunit Of The
           Second 70s Ribosome. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBH|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The First 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2QBJ|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 30s
           Subunit Of The Second 70s Ribosome, With Gentamicin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2Z4K|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The First 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2Z4M|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           30s Subunit Of The Second 70s Ribosome, With Paromomycin
           Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2VHO|M Chain M, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 3 Of 4)
 pdb|2VHP|M Chain M, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 4 Of 4)
 pdb|3DF1|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The First 70s Ribosome, With
           Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 pdb|3DF3|M Chain M, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 30s Subunit Of The Second 70s Ribosome,
           With Hygromycin B Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes.
 pdb|3J00|M Chain M, Structure Of The Ribosome-Secye Complex In The Membrane
           Environment
 pdb|4ADV|M Chain M, Structure Of The E. Coli Methyltransferase Ksga Bound To
           The E. Coli 30s Ribosomal Subunit
 pdb|3J0U|P Chain P, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class2 Of The Six
           Classes)
 pdb|3J0V|P Chain P, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class 4a Of The Six
           Classes)
 pdb|3J0X|P Chain P, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class 4b Of The Six
           Classes)
 pdb|3J0Z|P Chain P, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class 5 Of The Six
           Classes)
 pdb|3J10|P Chain P, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class 6 Of The Six
           Classes)
 pdb|3J13|O Chain O, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (30s Ribosome Of Class 3 Of The Six
           Classes)
          Length = 117

 Score =  103 bits (257), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 75/114 (65%), Gaps = 1/114 (0%)

Query: 33  RVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIGNKL-TKELTGVELNSLREEVSR 91
           R+    IP+ K    +L  +YG+G++R+  IL    I   +   EL+  ++++LR+EV++
Sbjct: 2   RIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAK 61

Query: 92  YLTGEDLRRCIKNDVERLVDIQCYRGIRHSQGLPCRGQRTSTNARTRKGKRVAI 145
           ++   DLRR I   ++RL+D+ CYRG+RH +GLP RGQRT TNARTRKG R  I
Sbjct: 62  FVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPI 115


>pdb|2GY9|M Chain M, Structure Of The 30s Subunit Of A Pre-Translocational E.
           Coli Ribosome Obtained By Fitting Atomic Models For Rna
           And Protein Components Into Cryo-Em Map Emd-1056
 pdb|2GYB|M Chain M, Structure Of The 30s Subunit Of A Secm-Stalled E. Coli
           Ribosome Complex Obtained By Fitting Atomic Models For
           Rna And Protein Components Into Cryo-Em Map Emd-1143
          Length = 115

 Score =  103 bits (257), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 75/114 (65%), Gaps = 1/114 (0%)

Query: 33  RVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIGNKL-TKELTGVELNSLREEVSR 91
           R+    IP+ K    +L  +YG+G++R+  IL    I   +   EL+  ++++LR+EV++
Sbjct: 2   RIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAK 61

Query: 92  YLTGEDLRRCIKNDVERLVDIQCYRGIRHSQGLPCRGQRTSTNARTRKGKRVAI 145
           ++   DLRR I   ++RL+D+ CYRG+RH +GLP RGQRT TNARTRKG R  I
Sbjct: 62  FVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPI 115


>pdb|3OFO|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 pdb|3OFA|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The First 70s Ribosome.
 pdb|3OFX|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 pdb|3OAQ|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           First 70s Ribosome.
 pdb|2YKR|M Chain M, 30s Ribosomal Subunit With Rsga Bound In The Presence Of
           Gmppnp
 pdb|4A2I|M Chain M, Cryo-Electron Microscopy Structure Of The 30s Subunit In
           Complex With The Yjeq Biogenesis Factor
 pdb|3J18|M Chain M, Structure Of The Bacterial Ribosome Complexed By
           Tmrna-Smpb And Ef-G During Translocation And Mld-Loading
           (30s Subunit)
 pdb|4GD1|M Chain M, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
 pdb|4GD2|M Chain M, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
          Length = 114

 Score =  103 bits (256), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 74/111 (66%), Gaps = 1/111 (0%)

Query: 33  RVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIGNKL-TKELTGVELNSLREEVSR 91
           R+    IP+ K    +L  +YG+G++R+  IL    I   +   EL+  ++++LR+EV++
Sbjct: 2   RIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAK 61

Query: 92  YLTGEDLRRCIKNDVERLVDIQCYRGIRHSQGLPCRGQRTSTNARTRKGKR 142
           ++   DLRR I   ++RL+D+ CYRG+RH +GLP RGQRT TNARTRKG R
Sbjct: 62  FVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPR 112


>pdb|3FIH|M Chain M, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
           Consists Of The 30s Subunit, Trnas And The Ternary
           Complex.
 pdb|2WWL|M Chain M, E.Coli 70s Ribosome Stalled During Translation Of Tnac
           Leader Peptide. This File Contains The 30s, The P-Site
           Trna And The Tnac Leader Peptide (Part 1 Of 2).
 pdb|3OFP|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome.
 pdb|3OFB|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 30s Subunit Of
           The Second 70s Ribosome.
 pdb|3OFY|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome
 pdb|3OAR|M Chain M, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 30s Subunit Of The
           Second 70s Ribosome
          Length = 113

 Score =  103 bits (256), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 74/111 (66%), Gaps = 1/111 (0%)

Query: 33  RVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIGNKL-TKELTGVELNSLREEVSR 91
           R+    IP+ K    +L  +YG+G++R+  IL    I   +   EL+  ++++LR+EV++
Sbjct: 2   RIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAK 61

Query: 92  YLTGEDLRRCIKNDVERLVDIQCYRGIRHSQGLPCRGQRTSTNARTRKGKR 142
           ++   DLRR I   ++RL+D+ CYRG+RH +GLP RGQRT TNARTRKG R
Sbjct: 62  FVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPR 112


>pdb|3PYN|M Chain M, Crystal Structure Of A Complex Containing Domain 3 From
           The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
           File Contains The 30s Subunit Of The First 70s Ribosome.
 pdb|3PYQ|M Chain M, Crystal Structure Of A Complex Containing Domain 3 From
           The Psiv Igr Ires Rna Bound To The 70s Ribosome. This
           File Contains The 30s Subunit Of The Second 70s
           Ribosome.
 pdb|3PYS|M Chain M, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
           Igr Ires Rna Bound To The 70s Ribosome. This File
           Contains The 30s Subunit Of The First 70s Ribosome.
 pdb|3PYU|M Chain M, Crystal Structure Of A Complex Containing Domain 3 Of Crpv
           Igr Ires Rna Bound To The 70s Ribosome. This File
           Contains The 30s Subunit Of The Second 70s Ribosome
          Length = 116

 Score = 99.0 bits (245), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 75/113 (66%), Gaps = 4/113 (3%)

Query: 33  RVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIGNKLT--KELTGVELNSLREEVS 90
           R+   EIP +KR++ +L ++YGIG++RA + L    I N  T  K+LT  E+  LRE V 
Sbjct: 2   RIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGI-NPATRVKDLTEAEVVRLREYVE 60

Query: 91  RYLTGE-DLRRCIKNDVERLVDIQCYRGIRHSQGLPCRGQRTSTNARTRKGKR 142
                E +LR  +  +++RL+DI CYRG+RH +GLP RGQRT TNARTRKG R
Sbjct: 61  NTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPR 113


>pdb|3MR8|M Chain M, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3mr8 Contains 30s Ribosomal Subunit. The 50s
           Ribosomal Subunit Can Be Found In Pdb Entry 3ms1.
           Molecule B In The Same Asymmetric Unit Is Deposited As
           3mrz (50s) And 3ms0 (30s).
 pdb|3MS0|M Chain M, Recognition Of The Amber Stop Codon By Release Factor Rf1.
           This Entry 3ms0 Contains 30s Ribosomal Subunit. The 50s
           Ribosomal Subunit Can Be Found In Pdb Entry 3mrz.
           Molecule A In The Same Asymmetric Unit Is Deposited As
           3mr8 (30s) And 3ms1 (50s)
          Length = 117

 Score = 99.0 bits (245), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 55/113 (48%), Positives = 75/113 (66%), Gaps = 4/113 (3%)

Query: 33  RVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIGNKLT--KELTGVELNSLREEVS 90
           R+   EIP +KR++ +L ++YGIG++RA + L    I N  T  K+LT  E+  LRE V 
Sbjct: 2   RIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGI-NPATRVKDLTEAEVVRLREYVE 60

Query: 91  RYLTGE-DLRRCIKNDVERLVDIQCYRGIRHSQGLPCRGQRTSTNARTRKGKR 142
                E +LR  +  +++RL+DI CYRG+RH +GLP RGQRT TNARTRKG R
Sbjct: 61  NTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPR 113


>pdb|3J20|O Chain O, Promiscuous Behavior Of Proteins In Archaeal Ribosomes
           Revealed By Cryo-em: Implications For Evolution Of
           Eukaryotic Ribosomes (30s Ribosomal Subunit)
          Length = 148

 Score = 54.3 bits (129), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 70/144 (48%), Gaps = 28/144 (19%)

Query: 32  LRVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIGNKLTKE--LTGVELNSLRE-- 87
           +RV   ++  +K+L  +L  + GIG + A  ++C +   +   K   LT  ++  + E  
Sbjct: 8   VRVAGVDLDGNKQLRWALTAIKGIGINFA-TMVCRVAGLDPFMKAGYLTDEQVKKIEEIL 66

Query: 88  -----------EVSR---YLTGEDLR-------RCIKNDVERLVDIQCYRGIRHSQGLPC 126
                       V+R   Y TG DL          I+ D+ RL  I+ YRGIRH  GLP 
Sbjct: 67  ADPVAHGIPRWAVNRPKDYETGRDLHLITAKLDMAIREDIMRLRRIRAYRGIRHELGLPV 126

Query: 127 RGQRTSTNARTRKGKRVAIPGKKK 150
           RGQRT +N   R+G+ V +  KKK
Sbjct: 127 RGQRTRSN--FRRGQTVGVSRKKK 148


>pdb|2ZKQ|MM Chain m, Structure Of A Mammalian Ribosomal 40s Subunit Within An
           80s Complex Obtained By Docking Homology Models Of The
           Rna And Proteins Into An 8.7 A Cryo-Em Map
          Length = 152

 Score = 48.1 bits (113), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 66/143 (46%), Gaps = 28/143 (19%)

Query: 32  LRVGNTEIPNDKRLETSLQHVYGIGRSRAHQIL--CDLNIGNKLTKELTGVEL------- 82
           LRV NT I   +++  ++  + G+GR  AH +L   D+++  K   ELT  E+       
Sbjct: 13  LRVLNTNIDGRRKIAFAITAIKGVGRRYAHVVLRKADIDL-TKRAGELTEDEVERVITIM 71

Query: 83  -NSLREEVSRYLT---------------GEDLRRCIKNDVERLVDIQCYRGIRHSQGLPC 126
            N  + ++  +                    L   ++ D+ERL  I+ +RG+RH  GL  
Sbjct: 72  QNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRAHRGLRHFWGLRV 131

Query: 127 RGQRTSTNARTRKGKRVAIPGKK 149
           RGQ T T    R+G+ V +  KK
Sbjct: 132 RGQHTKTTG--RRGRTVGVSKKK 152


>pdb|3IZ6|M Chain M, Localization Of The Small Subunit Ribosomal Proteins Into
           A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s
           Ribosome
          Length = 152

 Score = 47.0 bits (110), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 70/146 (47%), Gaps = 34/146 (23%)

Query: 32  LRVGNTEIPNDKRLETSLQHVYGIGRSRAHQILC---DLNIGNKLTKELTGVELNSLREE 88
           LRV NT +   +++  +L  + G+GR R   I+C   D+++ NK   EL+  E++ L   
Sbjct: 13  LRVLNTNVDGKQKIMFALTSIKGVGR-RFSNIVCKKADIDM-NKRAGELSAEEMDRLMAV 70

Query: 89  VSR----------------YLTGE---------DLRRCIKNDVERLVDIQCYRGIRHSQG 123
           V                  Y  G          D++  +++D+ERL  I+ +RG+RH  G
Sbjct: 71  VHNPRQFKVPDWFLNRKKDYKDGRFSQVVSNAVDMK--LRDDLERLKKIRNHRGLRHYWG 128

Query: 124 LPCRGQRTSTNARTRKGKRVAIPGKK 149
           +  RGQ T T    R+GK V +  K+
Sbjct: 129 VRVRGQHTKTTG--RRGKTVGVSKKR 152


>pdb|3IZB|M Chain M, Localization Of The Small Subunit Ribosomal Proteins Into
           A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae
           Translating 80s Ribosome
 pdb|3O2Z|L Chain L, Yeast 80s Ribosome. This Entry Consists Of The 40s Subunit
           Of The First 80s In The Asymmetric Unit.
 pdb|3O30|L Chain L, Yeast 80s Ribosome. This Entry Consists Of The 40s Subunit
           Of The Second 80s In The Asymmetric Unit.
 pdb|3U5C|S Chain S, The Structure Of The Eukaryotic Ribosome At 3.0 A
           Resolution. This Entry Contains Proteins Of The 40s
           Subunit, Ribosome A
 pdb|3U5G|S Chain S, The Structure Of The Eukaryotic Ribosome At 3.0 A
           Resolution. This Entry Contains Proteins Of The 40s
           Subunit, Ribosome B
          Length = 146

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 62/133 (46%), Gaps = 28/133 (21%)

Query: 32  LRVGNTEIPNDKRLETSLQHVYGIGRSRAHQILC---DLNIGNKLTKELTGVEL------ 82
           LR+ NT +  + ++  +L  + G+GR R   ++C   D+++ +K   ELT  EL      
Sbjct: 15  LRLLNTNVDGNIKIVYALTTIKGVGR-RYSNLVCKKADVDL-HKRAGELTQEELERIVQI 72

Query: 83  -----------------NSLREEVSRYLTGEDLRRCIKNDVERLVDIQCYRGIRHSQGLP 125
                            N + +    +    ++   +++D+ERL  I+ +RGIRH  GL 
Sbjct: 73  MQNPTHYKIPAWFLNRQNDITDGKDYHTLANNVESKLRDDLERLKKIRAHRGIRHFWGLR 132

Query: 126 CRGQRTSTNARTR 138
            RGQ T T  R R
Sbjct: 133 VRGQHTKTTGRRR 145


>pdb|1S1H|M Chain M, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From
           Yeast Obtained By Docking Atomic Models For Rna And
           Protein Components Into A 11.7 A Cryo-Em Map. This File,
           1s1h, Contains 40s Subunit. The 60s Ribosomal Subunit Is
           In File 1s1i
          Length = 132

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 62/133 (46%), Gaps = 28/133 (21%)

Query: 32  LRVGNTEIPNDKRLETSLQHVYGIGRSRAHQILC---DLNIGNKLTKELTGVEL------ 82
           LR+ NT +  + ++  +L  + G+GR R   ++C   D+++ +K   ELT  EL      
Sbjct: 1   LRLLNTNVDGNIKIVYALTTIKGVGR-RYSNLVCKKADVDL-HKRAGELTQEELERIVQI 58

Query: 83  -----------------NSLREEVSRYLTGEDLRRCIKNDVERLVDIQCYRGIRHSQGLP 125
                            N + +    +    ++   +++D+ERL  I+ +RGIRH  GL 
Sbjct: 59  MQNPTHYKIPAWFLNRQNDITDGKDYHTLANNVESKLRDDLERLKKIRAHRGIRHFWGLR 118

Query: 126 CRGQRTSTNARTR 138
            RGQ T T  R R
Sbjct: 119 VRGQHTKTTGRRR 131


>pdb|2XZM|M Chain M, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit
           In Complex With Initiation Factor 1. This File Contains
           The 40s Subunit And Initiation Factor For Molecule 1
 pdb|2XZN|M Chain M, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit
           In Complex With Initiation Factor 1. This File Contains
           The 40s Subunit And Initiation Factor For Molecule 2
          Length = 155

 Score = 43.1 bits (100), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 55/128 (42%), Gaps = 24/128 (18%)

Query: 33  RVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIG-------------NKLTKELTG 79
           R+ NT I   +    +L  + GIGR  A+ I   L I              NK+T  +  
Sbjct: 16  RILNTNIDGKRITPIALTGIRGIGRRFAYIICKVLKIDPNARAGLLTEDQCNKITDLIAD 75

Query: 80  VE-----------LNSLREEVSRYLTGEDLRRCIKNDVERLVDIQCYRGIRHSQGLPCRG 128
            E           +N  ++  +  +    L   ++ D+ERL  I+ +RG+RH  GL  RG
Sbjct: 76  PEAHGIPTWLLNRINDFKDGKNYQMASNTLDTKMREDLERLKKIKSHRGLRHFWGLKVRG 135

Query: 129 QRTSTNAR 136
           Q T T+ R
Sbjct: 136 QHTKTSGR 143


>pdb|3ZEY|M Chain M, High-resolution Cryo-electron Microscopy Structure Of The
           Trypanosoma Brucei Ribosome
          Length = 153

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 69/151 (45%), Gaps = 30/151 (19%)

Query: 19  IQTISFHGLRVQGLRVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIG-NKLTKEL 77
           +Q+ SF  +    +R+ NT +   +++  +L+ V GIG   A+ +     +   +    L
Sbjct: 5   LQSESFQHI----VRLLNTNVEGKRKVPFALRMVKGIGIRFAYMVCKKAGVDVERRAGTL 60

Query: 78  TGVELNSLREEVS-----------------------RYLTGEDLRRCIKNDVERLVDIQC 114
           +  EL  + E ++                        +LT   +   ++ D+ERL  I+ 
Sbjct: 61  SPEELEKISEVIADPAKFKIPEWFLNRQRDPKTGKTEHLTSSMVDTRLREDLERLRKIRA 120

Query: 115 YRGIRHSQGLPCRGQRTSTNARTRKGKRVAI 145
           +RG+RH+ GL  RGQ T T+   R+GK V +
Sbjct: 121 HRGVRHAYGLRVRGQHTCTSG--RRGKTVGV 149


>pdb|3JYV|M Chain M, Structure Of The 40s Rrna And Proteins And PE TRNA FOR
           EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces
           Lanuginosus Ribosome At 8.9a Resolution
          Length = 130

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 61/132 (46%), Gaps = 28/132 (21%)

Query: 33  RVGNTEIPNDKRLETSLQHVYGIGRSRAHQILC---DLNIGNKLTKELTGVEL------- 82
           R+ NT +  + ++  +L  + G+GR R   ++C   D+++ +K   ELT  EL       
Sbjct: 1   RLLNTNVDGNIKIVYALTTIKGVGR-RYSNLVCKKADVDL-HKRAGELTQEELERIVQIM 58

Query: 83  ----------------NSLREEVSRYLTGEDLRRCIKNDVERLVDIQCYRGIRHSQGLPC 126
                           N + +    +    ++   +++D+ERL  I+ +RGIRH  GL  
Sbjct: 59  QNPTHYKIPAWFLNRQNDITDGKDYHTLANNVESKLRDDLERLKKIRAHRGIRHFWGLRV 118

Query: 127 RGQRTSTNARTR 138
           RGQ T T  R R
Sbjct: 119 RGQHTKTTGRRR 130


>pdb|1G3S|A Chain A, Cys102ser Dtxr
 pdb|1G3T|A Chain A, Cys102ser Dtxr
 pdb|1G3T|B Chain B, Cys102ser Dtxr
 pdb|1G3W|A Chain A, Cd-Cys102ser Dtxr
          Length = 226

 Score = 26.6 bits (57), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 56  GRSRAHQILCDLNIGNKLTKELTGVELNSLREEVSRY---LTGEDLRRCIK--NDVER 108
           GR+ A  ++    +  +L  ++ G+++N + +E SR+   ++ E  RR +K   DV R
Sbjct: 68  GRTLATAVMRKHRLAERLLTDIIGLDINKVHDEASRWEHVMSDEVERRLVKVLKDVSR 125


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.136    0.391 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,033,438
Number of Sequences: 62578
Number of extensions: 154986
Number of successful extensions: 360
Number of sequences better than 100.0: 22
Number of HSP's better than 100.0 without gapping: 18
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 328
Number of HSP's gapped (non-prelim): 23
length of query: 153
length of database: 14,973,337
effective HSP length: 90
effective length of query: 63
effective length of database: 9,341,317
effective search space: 588502971
effective search space used: 588502971
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 47 (22.7 bits)