Citrus Sinensis ID: 031757


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MISLRNSVGMLSNVSRQLIQTISFHGLRVQGLRVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIGNKLTKELTGVELNSLREEVSRYLTGEDLRRCIKNDVERLVDIQCYRGIRHSQGLPCRGQRTSTNARTRKGKRVAIPGKKKPTR
cccccccccccccHHHHHHcccccccEEEEEEEEEcccccccccEEEEEEEEEcccHHHHHHHHHHccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccc
************NVSRQLIQTISFHGLRVQGLRVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIGNKLTKELTGVELNSLREEVSRYLTGEDLRRCIKNDVERLVDIQCYRGIRHSQGLPC***************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISLRNSVGMLSNVSRQLIQTISFHGLRVQGLRVGNTEIPNDKRLETSLQHVYGIGRSRAHQILCDLNIGNKLTKELTGVELNSLREEVSRYLTGEDLRRCIKNDVERLVDIQCYRGIRHSQGLPCRGQRTSTNARTRKGKRVAIPGKKKPTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Small ribosomal subunit protein S13, mitochondrial Located at the top of the head of the small subunit, it contacts several helices of the 18S rRNA.probableQ9CA19
30S ribosomal protein S13 Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.probableQ6KI31
30S ribosomal protein S13 Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites.probableQ4A5I8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBN, chain M
Confidence level:very confident
Coverage over the Query: 32-88,99-140
View the alignment between query and template
View the model in PyMOL
Template: 2XZM, chain M
Confidence level:very confident
Coverage over the Query: 14-149
View the alignment between query and template
View the model in PyMOL