Citrus Sinensis ID: 031761
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 153 | ||||||
| 224133664 | 134 | predicted protein [Populus trichocarpa] | 0.836 | 0.955 | 0.687 | 2e-47 | |
| 356559276 | 157 | PREDICTED: senescence-associated protein | 0.790 | 0.770 | 0.685 | 5e-44 | |
| 351722436 | 158 | uncharacterized protein LOC100305809 [Gl | 0.790 | 0.765 | 0.661 | 1e-41 | |
| 356496631 | 149 | PREDICTED: thiosulfate sulfurtransferase | 0.849 | 0.872 | 0.604 | 1e-41 | |
| 225431104 | 129 | PREDICTED: thiosulfate sulfurtransferase | 0.764 | 0.906 | 0.649 | 2e-40 | |
| 357483815 | 145 | Thiosulfate sulfurtransferase [Medicago | 0.908 | 0.958 | 0.592 | 2e-40 | |
| 358248854 | 149 | uncharacterized protein LOC100803436 pre | 0.875 | 0.899 | 0.594 | 2e-40 | |
| 357518001 | 131 | Thiosulfate sulfurtransferase [Medicago | 0.784 | 0.916 | 0.641 | 6e-40 | |
| 388515829 | 152 | unknown [Lotus japonicus] | 0.790 | 0.796 | 0.644 | 7e-40 | |
| 388521019 | 150 | unknown [Lotus japonicus] | 0.947 | 0.966 | 0.577 | 2e-39 |
| >gi|224133664|ref|XP_002327650.1| predicted protein [Populus trichocarpa] gi|222836735|gb|EEE75128.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 193 bits (491), Expect = 2e-47, Method: Compositional matrix adjust.
Identities = 88/128 (68%), Positives = 106/128 (82%)
Query: 22 RSSGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKN 81
+S+GAEV+TVDV+A K LLESGY YLDVRT EE+ +GHVD KIFNIPY+FNTPEGRVKN
Sbjct: 6 KSTGAEVVTVDVKATKGLLESGYTYLDVRTVEEYNKGHVDGEKIFNIPYLFNTPEGRVKN 65
Query: 82 PDFLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAGFKHVSNFGGGHMAWVQNGLKVK 141
P+FLK+V +CKEED+L+VGCQSG RSL+ATADLL AGFK VSN GGG++AW +N VK
Sbjct: 66 PNFLKEVSGVCKEEDKLLVGCQSGVRSLYATADLLSAGFKDVSNVGGGYLAWTENVFPVK 125
Query: 142 AREKPADH 149
++ D
Sbjct: 126 IEKRERDE 133
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356559276|ref|XP_003547926.1| PREDICTED: senescence-associated protein DIN1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|351722436|ref|NP_001236988.1| uncharacterized protein LOC100305809 [Glycine max] gi|255626667|gb|ACU13678.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356496631|ref|XP_003517169.1| PREDICTED: thiosulfate sulfurtransferase, chloroplastic-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225431104|ref|XP_002265009.1| PREDICTED: thiosulfate sulfurtransferase, chloroplastic [Vitis vinifera] gi|297734996|emb|CBI17358.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|357483815|ref|XP_003612194.1| Thiosulfate sulfurtransferase [Medicago truncatula] gi|355513529|gb|AES95152.1| Thiosulfate sulfurtransferase [Medicago truncatula] gi|388513883|gb|AFK45003.1| unknown [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|358248854|ref|NP_001240207.1| uncharacterized protein LOC100803436 precursor [Glycine max] gi|255638114|gb|ACU19371.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357518001|ref|XP_003629289.1| Thiosulfate sulfurtransferase [Medicago truncatula] gi|355523311|gb|AET03765.1| Thiosulfate sulfurtransferase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|388515829|gb|AFK45976.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|388521019|gb|AFK48571.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 153 | ||||||
| TAIR|locus:2827795 | 156 | AT2G17850 "AT2G17850" [Arabido | 0.797 | 0.782 | 0.549 | 2e-33 | |
| TAIR|locus:2156882 | 138 | STR18 "AT5G66170" [Arabidopsis | 0.777 | 0.862 | 0.570 | 2.5e-33 | |
| TAIR|locus:505006261 | 169 | AT2G21045 [Arabidopsis thalian | 0.764 | 0.692 | 0.524 | 4.4e-29 | |
| UNIPROTKB|B2C7Y6 | 185 | NRIP1 "Chloroplast N receptor- | 0.699 | 0.578 | 0.504 | 5.9e-25 | |
| TAIR|locus:2156937 | 120 | STR16 "AT5G66040" [Arabidopsis | 0.725 | 0.925 | 0.513 | 7.6e-25 | |
| TAIR|locus:2128038 | 182 | SEN1 "AT4G35770" [Arabidopsis | 0.718 | 0.604 | 0.455 | 8.7e-24 | |
| UNIPROTKB|F1S179 | 131 | TSTD1 "Uncharacterized protein | 0.673 | 0.786 | 0.345 | 8.7e-08 | |
| TAIR|locus:2059999 | 234 | AT2G42220 "AT2G42220" [Arabido | 0.339 | 0.222 | 0.377 | 1.2e-07 | |
| UNIPROTKB|Q607E4 | 120 | MCA1816 "Sulfurtransferase" [M | 0.562 | 0.716 | 0.371 | 1.4e-07 | |
| POMBASE|SPAC4H3.07c | 142 | SPAC4H3.07c "protein phosphata | 0.594 | 0.640 | 0.303 | 2.9e-07 |
| TAIR|locus:2827795 AT2G17850 "AT2G17850" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 364 (133.2 bits), Expect = 2.0e-33, P = 2.0e-33
Identities = 67/122 (54%), Positives = 87/122 (71%)
Query: 24 SGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPD 83
S +VIT+DV A+ LL+SGY +LDVRT EEFK+GHVD+ +FN+PY TP+G+ NP+
Sbjct: 28 SEPKVITIDVNQAQKLLDSGYTFLDVRTVEEFKKGHVDSENVFNVPYWLYTPQGQEINPN 87
Query: 84 FLKKVRSLCKEEDRLVVGCQSGARSLHATADLLGAGFKHVSNFGGGHMAWVQNGLKVKAR 143
FLK V SLC + D L++GC+SG RSLHAT L+ +GFK V N GG++AWV VK
Sbjct: 88 FLKHVSSLCNQTDHLILGCKSGVRSLHATKFLVSSGFKTVRNMDGGYIAWVNKRFPVKVE 147
Query: 144 EK 145
K
Sbjct: 148 HK 149
|
|
| TAIR|locus:2156882 STR18 "AT5G66170" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006261 AT2G21045 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B2C7Y6 NRIP1 "Chloroplast N receptor-interacting protein 1" [Nicotiana benthamiana (taxid:4100)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156937 STR16 "AT5G66040" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2128038 SEN1 "AT4G35770" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S179 TSTD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2059999 AT2G42220 "AT2G42220" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q607E4 MCA1816 "Sulfurtransferase" [Methylococcus capsulatus str. Bath (taxid:243233)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC4H3.07c SPAC4H3.07c "protein phosphatase Fmp31 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 153 | |||
| PLN02160 | 136 | PLN02160, PLN02160, thiosulfate sulfurtransferase | 4e-47 | |
| smart00450 | 100 | smart00450, RHOD, Rhodanese Homology Domain | 7e-15 | |
| cd00158 | 89 | cd00158, RHOD, Rhodanese Homology Domain (RHOD); a | 3e-14 | |
| PRK08762 | 376 | PRK08762, PRK08762, molybdopterin biosynthesis pro | 2e-11 | |
| COG0607 | 110 | COG0607, PspE, Rhodanese-related sulfurtransferase | 3e-11 | |
| pfam00581 | 106 | pfam00581, Rhodanese, Rhodanese-like domain | 4e-11 | |
| cd01519 | 106 | cd01519, RHOD_HSP67B2, Member of the Rhodanese Hom | 9e-10 | |
| cd01522 | 117 | cd01522, RHOD_1, Member of the Rhodanese Homology | 2e-09 | |
| PRK07878 | 392 | PRK07878, PRK07878, molybdopterin biosynthesis-lik | 1e-07 | |
| PRK07411 | 390 | PRK07411, PRK07411, hypothetical protein; Validate | 1e-06 | |
| cd01447 | 103 | cd01447, Polysulfide_ST, Polysulfide-sulfurtransfe | 2e-06 | |
| cd01528 | 101 | cd01528, RHOD_2, Member of the Rhodanese Homology | 2e-06 | |
| PRK05597 | 355 | PRK05597, PRK05597, molybdopterin biosynthesis pro | 8e-06 | |
| cd01449 | 118 | cd01449, TST_Repeat_2, Thiosulfate sulfurtransfera | 1e-05 | |
| cd01529 | 96 | cd01529, 4RHOD_Repeats, Member of the Rhodanese Ho | 9e-05 | |
| cd01524 | 90 | cd01524, RHOD_Pyr_redox, Member of the Rhodanese H | 1e-04 | |
| PRK10287 | 104 | PRK10287, PRK10287, thiosulfate:cyanide sulfurtran | 1e-04 | |
| TIGR02981 | 101 | TIGR02981, phageshock_pspE, phage shock operon rho | 1e-04 | |
| COG2897 | 285 | COG2897, SseA, Rhodanese-related sulfurtransferase | 8e-04 | |
| cd01523 | 100 | cd01523, RHOD_Lact_B, Member of the Rhodanese Homo | 0.004 |
| >gnl|CDD|177819 PLN02160, PLN02160, thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
Score = 149 bits (376), Expect = 4e-47
Identities = 68/108 (62%), Positives = 86/108 (79%)
Query: 27 EVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLK 86
EV++VDV AK LL+SG+ YLDVRT +EF+ GH +AAKI NIPYM NTP+GRVKN +FL+
Sbjct: 13 EVVSVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQGRVKNQEFLE 72
Query: 87 KVRSLCKEEDRLVVGCQSGARSLHATADLLGAGFKHVSNFGGGHMAWV 134
+V SL D ++VGCQSGARSL AT +L+ AG+K V N GGG++AWV
Sbjct: 73 QVSSLLNPADDILVGCQSGARSLKATTELVAAGYKKVRNKGGGYLAWV 120
|
Length = 136 |
| >gnl|CDD|197731 smart00450, RHOD, Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >gnl|CDD|238089 cd00158, RHOD, Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >gnl|CDD|236337 PRK08762, PRK08762, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|223680 COG0607, PspE, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|216005 pfam00581, Rhodanese, Rhodanese-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|238777 cd01519, RHOD_HSP67B2, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238780 cd01522, RHOD_1, Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|181156 PRK07878, PRK07878, molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180967 PRK07411, PRK07411, hypothetical protein; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238724 cd01447, Polysulfide_ST, Polysulfide-sulfurtransferase - Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >gnl|CDD|238786 cd01528, RHOD_2, Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >gnl|CDD|235526 PRK05597, PRK05597, molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|238726 cd01449, TST_Repeat_2, Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|238787 cd01529, 4RHOD_Repeats, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238782 cd01524, RHOD_Pyr_redox, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|182356 PRK10287, PRK10287, thiosulfate:cyanide sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132026 TIGR02981, phageshock_pspE, phage shock operon rhodanese PspE | Back alignment and domain information |
|---|
| >gnl|CDD|225450 COG2897, SseA, Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|238781 cd01523, RHOD_Lact_B, Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 153 | |||
| PLN02160 | 136 | thiosulfate sulfurtransferase | 99.95 | |
| KOG1530 | 136 | consensus Rhodanese-related sulfurtransferase [Ino | 99.94 | |
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 99.92 | |
| PRK00162 | 108 | glpE thiosulfate sulfurtransferase; Validated | 99.91 | |
| cd01527 | 99 | RHOD_YgaP Member of the Rhodanese Homology Domain | 99.91 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 99.9 | |
| cd01519 | 106 | RHOD_HSP67B2 Member of the Rhodanese Homology Doma | 99.9 | |
| cd01523 | 100 | RHOD_Lact_B Member of the Rhodanese Homology Domai | 99.89 | |
| cd01534 | 95 | 4RHOD_Repeat_3 Member of the Rhodanese Homology Do | 99.89 | |
| TIGR03865 | 162 | PQQ_CXXCW PQQ-dependent catabolism-associated CXXC | 99.89 | |
| cd01521 | 110 | RHOD_PspE2 Member of the Rhodanese Homology Domain | 99.89 | |
| cd01528 | 101 | RHOD_2 Member of the Rhodanese Homology Domain sup | 99.88 | |
| cd01524 | 90 | RHOD_Pyr_redox Member of the Rhodanese Homology Do | 99.88 | |
| cd01520 | 128 | RHOD_YbbB Member of the Rhodanese Homology Domain | 99.88 | |
| cd01444 | 96 | GlpE_ST GlpE sulfurtransferase (ST) and homologs a | 99.88 | |
| cd01526 | 122 | RHOD_ThiF Member of the Rhodanese Homology Domain | 99.88 | |
| cd01447 | 103 | Polysulfide_ST Polysulfide-sulfurtransferase - Rho | 99.87 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 99.87 | |
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 99.87 | |
| cd01535 | 145 | 4RHOD_Repeat_4 Member of the Rhodanese Homology Do | 99.86 | |
| cd01449 | 118 | TST_Repeat_2 Thiosulfate sulfurtransferase (TST), | 99.86 | |
| cd01525 | 105 | RHOD_Kc Member of the Rhodanese Homology Domain su | 99.86 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 99.86 | |
| smart00450 | 100 | RHOD Rhodanese Homology Domain. An alpha beta fold | 99.86 | |
| cd01530 | 121 | Cdc25 Cdc25 phosphatases are members of the Rhodan | 99.86 | |
| PF00581 | 113 | Rhodanese: Rhodanese-like domain This Prosite entr | 99.85 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 99.84 | |
| cd01529 | 96 | 4RHOD_Repeats Member of the Rhodanese Homology Dom | 99.83 | |
| PRK01415 | 247 | hypothetical protein; Validated | 99.83 | |
| cd01532 | 92 | 4RHOD_Repeat_1 Member of the Rhodanese Homology Do | 99.83 | |
| PRK09629 | 610 | bifunctional thiosulfate sulfurtransferase/phospha | 99.82 | |
| cd01445 | 138 | TST_Repeats Thiosulfate sulfurtransferases (TST) c | 99.82 | |
| TIGR02981 | 101 | phageshock_pspE phage shock operon rhodanese PspE. | 99.82 | |
| PLN02723 | 320 | 3-mercaptopyruvate sulfurtransferase | 99.82 | |
| cd01531 | 113 | Acr2p Eukaryotic arsenate resistance proteins are | 99.82 | |
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 99.81 | |
| PRK10287 | 104 | thiosulfate:cyanide sulfurtransferase; Provisional | 99.81 | |
| cd00158 | 89 | RHOD Rhodanese Homology Domain (RHOD); an alpha be | 99.81 | |
| PRK11493 | 281 | sseA 3-mercaptopyruvate sulfurtransferase; Provisi | 99.8 | |
| PRK05320 | 257 | rhodanese superfamily protein; Provisional | 99.8 | |
| PLN02723 | 320 | 3-mercaptopyruvate sulfurtransferase | 99.8 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 99.8 | |
| cd01443 | 113 | Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda | 99.8 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 99.78 | |
| PRK09629 | 610 | bifunctional thiosulfate sulfurtransferase/phospha | 99.77 | |
| COG2897 | 285 | SseA Rhodanese-related sulfurtransferase [Inorgani | 99.75 | |
| PRK11784 | 345 | tRNA 2-selenouridine synthase; Provisional | 99.75 | |
| PRK07411 | 390 | hypothetical protein; Validated | 99.74 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 99.74 | |
| COG2897 | 285 | SseA Rhodanese-related sulfurtransferase [Inorgani | 99.74 | |
| TIGR03167 | 311 | tRNA_sel_U_synt tRNA 2-selenouridine synthase. The | 99.73 | |
| cd01446 | 132 | DSP_MapKP N-terminal regulatory rhodanese domain o | 99.7 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 99.65 | |
| COG1054 | 308 | Predicted sulfurtransferase [General function pred | 99.51 | |
| PRK01269 | 482 | tRNA s(4)U8 sulfurtransferase; Provisional | 99.51 | |
| KOG3772 | 325 | consensus M-phase inducer phosphatase [Cell cycle | 99.4 | |
| KOG1529 | 286 | consensus Mercaptopyruvate sulfurtransferase/thios | 99.4 | |
| KOG2017 | 427 | consensus Molybdopterin synthase sulfurylase [Coen | 99.27 | |
| COG5105 | 427 | MIH1 Mitotic inducer, protein phosphatase [Cell di | 98.94 | |
| KOG1529 | 286 | consensus Mercaptopyruvate sulfurtransferase/thios | 98.93 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 97.88 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 97.63 | |
| COG2603 | 334 | Predicted ATPase [General function prediction only | 97.51 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 96.87 | |
| KOG1093 | 725 | consensus Predicted protein kinase (contains TBC a | 96.84 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 96.5 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 96.34 | |
| PLN02727 | 986 | NAD kinase | 95.83 | |
| KOG3636 | 669 | consensus Uncharacterized conserved protein, conta | 95.28 | |
| KOG1717 | 343 | consensus Dual specificity phosphatase [Defense me | 94.33 | |
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 93.79 | |
| TIGR03167 | 311 | tRNA_sel_U_synt tRNA 2-selenouridine synthase. The | 92.69 | |
| COG3453 | 130 | Uncharacterized protein conserved in bacteria [Fun | 91.95 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 90.59 | |
| PF13344 | 101 | Hydrolase_6: Haloacid dehalogenase-like hydrolase; | 89.98 | |
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 89.61 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 87.83 | |
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 87.21 | |
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 86.43 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 86.27 | |
| PRK15416 | 201 | lipopolysaccharide core heptose(II)-phosphate phos | 85.13 | |
| PF03853 | 169 | YjeF_N: YjeF-related protein N-terminus; InterPro: | 84.7 | |
| COG0062 | 203 | Uncharacterized conserved protein [Function unknow | 80.79 |
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
Probab=99.95 E-value=5.1e-27 Score=162.50 Aligned_cols=124 Identities=56% Similarity=0.944 Sum_probs=106.6
Q ss_pred cCCcceeecHHHHHHHHhCCCeEEecCChhhhhcCCCCCcceeCccccccCCCCCCCChHHHHHHHhhccCCCeEEEEeC
Q 031761 24 SGAEVITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVVGCQ 103 (153)
Q Consensus 24 ~~~~~~~i~~~~~~~~~~~~~~iIDvR~~~e~~~ghi~ga~~i~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~ivi~c~ 103 (153)
..+.+..+++.++.++++++..|||||++.||..||||||..+|+|+....+...+..+++...+...++++++||+||+
T Consensus 10 ~~~~~~~i~~~e~~~~~~~~~~lIDVR~~~E~~~ghIpgA~~iniP~~~~~~~~~l~~~~~~~~~~~~~~~~~~IivyC~ 89 (136)
T PLN02160 10 KAEEVVSVDVSQAKTLLQSGHQYLDVRTQDEFRRGHCEAAKIVNIPYMLNTPQGRVKNQEFLEQVSSLLNPADDILVGCQ 89 (136)
T ss_pred CceeeeEeCHHHHHHHHhCCCEEEECCCHHHHhcCCCCCcceecccchhcCcccccCCHHHHHHHHhccCCCCcEEEECC
Confidence 34468899999999999877889999999999999999996678888655555566556676666554578999999999
Q ss_pred CCccHHHHHHHHHHCCccceeeccccHHHHHhCCCceecCCCCC
Q 031761 104 SGARSLHATADLLGAGFKHVSNFGGGHMAWVQNGLKVKAREKPA 147 (153)
Q Consensus 104 ~g~~a~~~~~~L~~~G~~~v~~l~gG~~~w~~~g~~~~~~~~~~ 147 (153)
+|.||..++..|...||++|+.|.||+.+|.++|+|+.+...++
T Consensus 90 sG~RS~~Aa~~L~~~G~~~v~~l~GG~~~W~~~g~p~~~~~~~~ 133 (136)
T PLN02160 90 SGARSLKATTELVAAGYKKVRNKGGGYLAWVDHSFPINQEEEEP 133 (136)
T ss_pred CcHHHHHHHHHHHHcCCCCeeecCCcHHHHhhCCCCccccccCC
Confidence 99999999999999999999999999999999999999887654
|
|
| >KOG1530 consensus Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
| >PRK00162 glpE thiosulfate sulfurtransferase; Validated | Back alignment and domain information |
|---|
| >cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein | Back alignment and domain information |
|---|
| >cd01521 RHOD_PspE2 Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
| >cd01535 4RHOD_Repeat_4 Member of the Rhodanese Homology Domain superfamily, repeat 4 | Back alignment and domain information |
|---|
| >cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain | Back alignment and domain information |
|---|
| >cd01525 RHOD_Kc Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >smart00450 RHOD Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >cd01530 Cdc25 Cdc25 phosphatases are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >cd01529 4RHOD_Repeats Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 | Back alignment and domain information |
|---|
| >PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >cd01445 TST_Repeats Thiosulfate sulfurtransferases (TST) contain 2 copies of the Rhodanese Homology Domain | Back alignment and domain information |
|---|
| >TIGR02981 phageshock_pspE phage shock operon rhodanese PspE | Back alignment and domain information |
|---|
| >PLN02723 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
| >cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >cd00158 RHOD Rhodanese Homology Domain (RHOD); an alpha beta fold domain found duplicated in the rhodanese protein | Back alignment and domain information |
|---|
| >PRK11493 sseA 3-mercaptopyruvate sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05320 rhodanese superfamily protein; Provisional | Back alignment and domain information |
|---|
| >PLN02723 3-mercaptopyruvate sulfurtransferase | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >PRK09629 bifunctional thiosulfate sulfurtransferase/phosphatidylserine decarboxylase; Provisional | Back alignment and domain information |
|---|
| >COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11784 tRNA 2-selenouridine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >COG2897 SseA Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase | Back alignment and domain information |
|---|
| >cd01446 DSP_MapKP N-terminal regulatory rhodanese domain of dual specificity phosphatases (DSP), such as Mapk Phosphatase | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >COG1054 Predicted sulfurtransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3772 consensus M-phase inducer phosphatase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG5105 MIH1 Mitotic inducer, protein phosphatase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1529 consensus Mercaptopyruvate sulfurtransferase/thiosulfate sulfurtransferase [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >COG2603 Predicted ATPase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only] | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >KOG3636 consensus Uncharacterized conserved protein, contains TBC and Rhodanese domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1717 consensus Dual specificity phosphatase [Defense mechanisms] | Back alignment and domain information |
|---|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase | Back alignment and domain information |
|---|
| >COG3453 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PRK15416 lipopolysaccharide core heptose(II)-phosphate phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF03853 YjeF_N: YjeF-related protein N-terminus; InterPro: IPR004443 The YjeF N-terminal domains occur either as single proteins or fusions with other domains and are commonly associated with enzymes | Back alignment and domain information |
|---|
| >COG0062 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 153 | ||||
| 1tq1_A | 129 | Solution Structure Of At5g66040, A Putative Protein | 1e-25 |
| >pdb|1TQ1|A Chain A, Solution Structure Of At5g66040, A Putative Protein From Arabidosis Thaliana Length = 129 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 153 | |||
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 8e-39 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 3e-22 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 9e-21 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 3e-20 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 4e-20 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 4e-19 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 8e-19 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 2e-18 | |
| 1wv9_A | 94 | Rhodanese homolog TT1651; CDC25, phosphatase, sulf | 3e-18 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 3e-18 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 6e-18 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 1e-17 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 7e-17 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 2e-16 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 1e-15 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 5e-14 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 5e-04 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 7e-14 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 5e-12 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 1e-07 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 4e-05 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 1e-13 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 8e-13 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 2e-12 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 2e-12 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 7e-12 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 9e-11 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 3e-10 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 4e-08 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 3e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-07 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 2e-06 | |
| 1c25_A | 161 | CDC25A; hydrolase, cell cycle phosphatase,dual spe | 5e-05 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 9e-05 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 1e-04 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 4e-04 |
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 Length = 129 | Back alignment and structure |
|---|
Score = 127 bits (320), Expect = 8e-39
Identities = 57/113 (50%), Positives = 72/113 (63%), Gaps = 2/113 (1%)
Query: 30 TVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVR 89
+V V A +LL +G+ YLDVRT EEF +GH A N+PYM G KN DFL++V
Sbjct: 19 SVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAI--NVPYMNRGASGMSKNTDFLEQVS 76
Query: 90 SLCKEEDRLVVGCQSGARSLHATADLLGAGFKHVSNFGGGHMAWVQNGLKVKA 142
S + D ++VGCQSG RS+ AT DLL AGF V + GG+ AW +NGL KA
Sbjct: 77 SHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTKA 129
|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Length = 139 | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A Length = 141 | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A Length = 106 | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Length = 137 | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Length = 139 | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} Length = 110 | Back alignment and structure |
|---|
| >1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Length = 94 | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Length = 134 | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Length = 108 | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Length = 100 | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Length = 108 | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Length = 148 | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Length = 85 | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 Length = 539 | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Length = 124 | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A Length = 144 | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Length = 588 | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 Length = 152 | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Length = 565 | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Length = 134 | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A Length = 423 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X Length = 271 | Back alignment and structure |
|---|
| >1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 Length = 161 | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 Length = 285 | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Length = 169 | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Length = 318 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 153 | |||
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.95 | |
| 1tq1_A | 129 | AT5G66040, senescence-associated family protein; C | 99.95 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 99.95 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 99.94 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 99.94 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 99.94 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 99.94 | |
| 3d1p_A | 139 | Putative thiosulfate sulfurtransferase YOR285W; at | 99.94 | |
| 3hix_A | 106 | ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q | 99.94 | |
| 3ilm_A | 141 | ALR3790 protein; rhodanese-like, NSR437H, NESG, st | 99.94 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 99.94 | |
| 2k0z_A | 110 | Uncharacterized protein HP1203; A/B domain, struct | 99.92 | |
| 3nhv_A | 144 | BH2092 protein; alpha-beta protein, structural gen | 99.92 | |
| 1wv9_A | 94 | Rhodanese homolog TT1651; CDC25, phosphatase, sulf | 99.92 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 99.92 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 99.91 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 99.9 | |
| 1t3k_A | 152 | Arath CDC25, dual-specificity tyrosine phosphatase | 99.9 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 99.89 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 99.89 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 99.88 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 99.88 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 99.88 | |
| 3i2v_A | 127 | Adenylyltransferase and sulfurtransferase MOCS3; r | 99.88 | |
| 1e0c_A | 271 | Rhodanese, sulfurtransferase; sulfur metabolism, t | 99.88 | |
| 1c25_A | 161 | CDC25A; hydrolase, cell cycle phosphatase,dual spe | 99.87 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 99.87 | |
| 1urh_A | 280 | 3-mercaptopyruvate sulfurtransferase; rhodanese; 2 | 99.87 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 99.87 | |
| 1rhs_A | 296 | Sulfur-substituted rhodanese; transferase, sulfurt | 99.87 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 99.87 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 99.87 | |
| 1qb0_A | 211 | Protein (M-phase inducer phosphatase 2 (CDC25B)); | 99.86 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 99.86 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 99.86 | |
| 2j6p_A | 152 | SB(V)-AS(V) reductase; arsenate reductase, antimon | 99.86 | |
| 2vsw_A | 153 | Dual specificity protein phosphatase 16; hydrolase | 99.86 | |
| 2a2k_A | 175 | M-phase inducer phosphatase 2; dual specificity, s | 99.86 | |
| 1uar_A | 285 | Rhodanese; sulfurtransferase, riken structural gen | 99.86 | |
| 3op3_A | 216 | M-phase inducer phosphatase 3; structural genomics | 99.86 | |
| 3aay_A | 277 | Putative thiosulfate sulfurtransferase; sulfurtran | 99.86 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 99.86 | |
| 4f67_A | 265 | UPF0176 protein LPG2838; structural genomics, PSI- | 99.85 | |
| 1okg_A | 373 | Possible 3-mercaptopyruvate sulfurtransferase; rho | 99.85 | |
| 2ouc_A | 142 | Dual specificity protein phosphatase 10; rhodanese | 99.85 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 99.84 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 99.83 | |
| 1yt8_A | 539 | Thiosulfate sulfurtransferase; rhodanase domains, | 99.83 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 99.83 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 99.83 | |
| 2wlr_A | 423 | Putative thiosulfate sulfurtransferase YNJE; rhoda | 99.82 | |
| 1hzm_A | 154 | Dual specificity protein phosphatase 6; hydrolase; | 99.8 | |
| 3tg1_B | 158 | Dual specificity protein phosphatase 10; kinase/rh | 99.8 | |
| 3ics_A | 588 | Coenzyme A-disulfide reductase; pyridine nucleotid | 99.79 | |
| 3ntd_A | 565 | FAD-dependent pyridine nucleotide-disulphide oxido | 99.79 | |
| 1okg_A | 373 | Possible 3-mercaptopyruvate sulfurtransferase; rho | 99.76 | |
| 1whb_A | 157 | KIAA0055; deubiqutinating enzyme, UBPY, structural | 99.75 | |
| 3utn_X | 327 | Thiosulfate sulfurtransferase TUM1; rhodanese-like | 99.74 | |
| 2gwf_A | 157 | Ubiquitin carboxyl-terminal hydrolase 8; protein-p | 99.74 | |
| 2eg4_A | 230 | Probable thiosulfate sulfurtransferase; structural | 99.73 | |
| 3tp9_A | 474 | Beta-lactamase and rhodanese domain protein; struc | 99.73 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 99.7 | |
| 3utn_X | 327 | Thiosulfate sulfurtransferase TUM1; rhodanese-like | 99.68 | |
| 3r2u_A | 466 | Metallo-beta-lactamase family protein; structural | 99.41 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 98.04 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 97.06 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 96.44 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 95.68 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 95.53 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 95.37 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 95.26 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 95.11 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 95.06 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 94.81 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 94.68 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 94.64 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 94.44 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 94.04 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 93.93 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 93.89 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 93.23 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 93.11 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 93.0 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 92.88 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 92.5 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 92.0 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 91.42 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 91.17 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 90.69 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 90.5 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 89.91 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 88.5 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 88.11 | |
| 1v8c_A | 168 | MOAD related protein; riken structural genomics/pr | 88.1 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 87.98 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 87.75 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 86.89 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 86.65 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 86.2 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 86.17 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 84.87 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 82.31 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 81.62 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 80.56 |
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
Probab=99.95 E-value=8.9e-29 Score=162.80 Aligned_cols=99 Identities=29% Similarity=0.408 Sum_probs=87.4
Q ss_pred eeecHHHHHHHHhC--CCeEEecCChhhhhcCCCCCcceeCccccccCCCCCCCChHHHHHHHhhccCCCeEEEEeCCCc
Q 031761 29 ITVDVRAAKNLLES--GYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVVGCQSGA 106 (153)
Q Consensus 29 ~~i~~~~~~~~~~~--~~~iIDvR~~~e~~~ghi~ga~~i~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~ivi~c~~g~ 106 (153)
.+||++|+.+.+.+ +.+|||||++.||..|||||| +|||+. +|.+.+.+ ++++++||+||.+|.
T Consensus 2 k~Is~~el~~~l~~~~~~~liDvR~~~e~~~ghIpgA--~~ip~~-----------~l~~~~~~-l~~~~~ivv~C~~G~ 67 (103)
T 3iwh_A 2 KSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNA--KLIPMD-----------TIPDNLNS-FNKNEIYYIVCAGGV 67 (103)
T ss_dssp CEECHHHHHHGGGSSSCCEEEECSCHHHHTTCBCTTC--EECCGG-----------GGGGCGGG-CCTTSEEEEECSSSS
T ss_pred CCcCHHHHHHHHhCCCCeEEEECCChhHHhcCccCCc--ccCccc-----------chhhhhhh-hcCCCeEEEECCCCH
Confidence 57999999998864 388999999999999999999 999996 44444444 489999999999999
Q ss_pred cHHHHHHHHHHCCccceeeccccHHHHHhCCCceec
Q 031761 107 RSLHATADLLGAGFKHVSNFGGGHMAWVQNGLKVKA 142 (153)
Q Consensus 107 ~a~~~~~~L~~~G~~~v~~l~gG~~~w~~~g~~~~~ 142 (153)
||..+++.|.+.||+++ .|.||+.+|.++|+|+++
T Consensus 68 rS~~aa~~L~~~G~~~~-~l~GG~~~W~~~g~pves 102 (103)
T 3iwh_A 68 RSAKVVEYLEANGIDAV-NVEGGMHAWGDEGLEIKS 102 (103)
T ss_dssp HHHHHHHHHHTTTCEEE-EETTHHHHHCSSSCBCCC
T ss_pred HHHHHHHHHHHcCCCEE-EecChHHHHHHCCCccee
Confidence 99999999999999865 689999999999999975
|
| >1tq1_A AT5G66040, senescence-associated family protein; CESG, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A | Back alignment and structure |
|---|
| >3ilm_A ALR3790 protein; rhodanese-like, NSR437H, NESG, structural genomics, protein structure initiative, northeast structural genomics consortium; 2.26A {Nostoc SP} PDB: 2kl3_A | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2k0z_A Uncharacterized protein HP1203; A/B domain, structural genomics, unknown function, PSI-2, PR structure initiative; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >3nhv_A BH2092 protein; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.50A {Bacillus halodurans} PDB: 3o3w_A | Back alignment and structure |
|---|
| >1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >1t3k_A Arath CDC25, dual-specificity tyrosine phosphatase; cell cycle, phosphorylation, plant, hydrolase; NMR {Arabidopsis thaliana} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >3i2v_A Adenylyltransferase and sulfurtransferase MOCS3; rhodanese, UBA4, structural genomics, ubiquitin biology, structural genomics consortium, SGC; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1e0c_A Rhodanese, sulfurtransferase; sulfur metabolism, thiosulfate:cyanide sulfurtransferase; 1.8A {Azotobacter vinelandii} SCOP: c.46.1.2 c.46.1.2 PDB: 1h4k_X 1h4m_X | Back alignment and structure |
|---|
| >1c25_A CDC25A; hydrolase, cell cycle phosphatase,dual specificity protein phosphatase, CDK2; 2.30A {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1urh_A 3-mercaptopyruvate sulfurtransferase; rhodanese; 2.8A {Escherichia coli} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >1rhs_A Sulfur-substituted rhodanese; transferase, sulfurtransferase; 1.36A {Bos taurus} SCOP: c.46.1.2 c.46.1.2 PDB: 1boh_A 1boi_A 1orb_A 2ora_A 1dp2_A* 1rhd_A | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >1qb0_A Protein (M-phase inducer phosphatase 2 (CDC25B)); hydrolase, cell cycle phosphatase, dual specificity protein phosphatase; 1.91A {Homo sapiens} SCOP: c.46.1.1 PDB: 1cwr_A 1cws_A 2uzq_A | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >2j6p_A SB(V)-AS(V) reductase; arsenate reductase, antimonate reductase, CDC25 phosphatase, rhodanese, C-MYC epitope, oxidoreductase; HET: EPE; 2.15A {Leishmania major} | Back alignment and structure |
|---|
| >2vsw_A Dual specificity protein phosphatase 16; hydrolase, dual specificity phosphatase, nucleus, cytoplasm, rhodanese domain, CAsp8; 2.20A {Homo sapiens} PDB: 3tg3_A | Back alignment and structure |
|---|
| >2a2k_A M-phase inducer phosphatase 2; dual specificity, substrate trapping, active site mutant, hydrolase; 1.52A {Homo sapiens} PDB: 2ifv_A 1ymd_A 1ym9_A 1ymk_A 1yml_A 1ys0_A 1cwt_A 2ifd_A | Back alignment and structure |
|---|
| >1uar_A Rhodanese; sulfurtransferase, riken structural genomics/PROT initiative, RSGI, structural genomics, transferase; 1.70A {Thermus thermophilus} SCOP: c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3op3_A M-phase inducer phosphatase 3; structural genomics, structural genomics consortium, SGC, Al alpha sandwich, kinase, cytosol, hydrolase; 2.63A {Homo sapiens} | Back alignment and structure |
|---|
| >3aay_A Putative thiosulfate sulfurtransferase; sulfurtranserase, structural genomics, PSI, structure initiative; 1.90A {Mycobacterium tuberculosis} PDB: 3aax_A 3hwi_A | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4f67_A UPF0176 protein LPG2838; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium; 1.79A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 | Back alignment and structure |
|---|
| >2ouc_A Dual specificity protein phosphatase 10; rhodanese fold, hydrolase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >1yt8_A Thiosulfate sulfurtransferase; rhodanase domains, cyanide detoxification, structural genomics, PSI, protein structure initiative; 1.90A {Pseudomonas aeruginosa} SCOP: c.46.1.2 c.46.1.2 c.46.1.2 c.46.1.2 | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* | Back alignment and structure |
|---|
| >2wlr_A Putative thiosulfate sulfurtransferase YNJE; rhodanese domains; HET: EPE; 1.45A {Escherichia coli} PDB: 2wlx_A* 3ipo_A* 3ipp_A | Back alignment and structure |
|---|
| >1hzm_A Dual specificity protein phosphatase 6; hydrolase; NMR {Homo sapiens} SCOP: c.46.1.1 | Back alignment and structure |
|---|
| >3tg1_B Dual specificity protein phosphatase 10; kinase/rhodanese-like domain, docking interaction, transfera hydrolase complex; 2.71A {Homo sapiens} | Back alignment and structure |
|---|
| >3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* | Back alignment and structure |
|---|
| >3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* | Back alignment and structure |
|---|
| >1okg_A Possible 3-mercaptopyruvate sulfurtransferase; rhodanese, prolyl isomerase, catalytic triad, serine protease, leishmania pyruvate; HET: CSR; 2.10A {Leishmania major} SCOP: c.46.1.2 c.46.1.2 d.26.1.3 | Back alignment and structure |
|---|
| >1whb_A KIAA0055; deubiqutinating enzyme, UBPY, structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; NMR {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2gwf_A Ubiquitin carboxyl-terminal hydrolase 8; protein-protein complex, E3 ligase, protein ubiquitination, hydrolase, protease, UBL conjugation pathway; 2.30A {Homo sapiens} SCOP: c.46.1.4 | Back alignment and structure |
|---|
| >2eg4_A Probable thiosulfate sulfurtransferase; structural genomics, NPPSFA, national Pro protein structural and functional analyses; 1.70A {Thermus thermophilus} PDB: 2eg3_A | Back alignment and structure |
|---|
| >3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3utn_X Thiosulfate sulfurtransferase TUM1; rhodanese-like domain; 1.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >1v8c_A MOAD related protein; riken structural genomics/proteomics initiative, RSGI, structural genomics, protein binding; 1.60A {Thermus thermophilus} SCOP: d.15.3.1 d.129.5.1 | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 153 | ||||
| d1tq1a_ | 119 | c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senesc | 1e-22 | |
| d1gmxa_ | 108 | c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia | 3e-10 | |
| d1e0ca2 | 136 | c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacte | 7e-10 | |
| d1qxna_ | 137 | c.46.1.3 (A:) Polysulfide-sulfur transferase (sulf | 1e-08 | |
| d1urha2 | 120 | c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtran | 5e-07 | |
| d1yt8a1 | 136 | c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase | 1e-06 | |
| d1e0ca1 | 135 | c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter | 2e-06 | |
| d1yt8a3 | 157 | c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase | 3e-06 | |
| d1hzma_ | 154 | c.46.1.1 (A:) Erk2 binding domain of Mapk phosphat | 4e-06 | |
| d1okga2 | 139 | c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtran | 7e-06 | |
| d1c25a_ | 161 | c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: | 2e-05 | |
| d1yt8a4 | 130 | c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase | 4e-05 | |
| d1rhsa2 | 144 | c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [ | 1e-04 | |
| d1yt8a2 | 101 | c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase P | 1e-04 | |
| d1t3ka_ | 132 | c.46.1.1 (A:) Dual specificity phosphatase Cdc25 { | 3e-04 | |
| d1urha1 | 147 | c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransf | 6e-04 | |
| d1uara2 | 141 | c.46.1.2 (A:145-285) Sulfurtransferase {Thermus th | 0.001 | |
| d2gwfa1 | 135 | c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal h | 0.002 |
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 119 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Rhodanese/Cell cycle control phosphatase superfamily: Rhodanese/Cell cycle control phosphatase family: Single-domain sulfurtransferase domain: Thiosulfate sulfurtransferase/Senescence-associated protein species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 84.5 bits (208), Expect = 1e-22
Identities = 57/113 (50%), Positives = 72/113 (63%), Gaps = 2/113 (1%)
Query: 30 TVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVR 89
+V V A +LL +G+ YLDVRT EEF +GH A N+PYM G KN DFL++V
Sbjct: 9 SVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGAI--NVPYMNRGASGMSKNTDFLEQVS 66
Query: 90 SLCKEEDRLVVGCQSGARSLHATADLLGAGFKHVSNFGGGHMAWVQNGLKVKA 142
S + D ++VGCQSG RS+ AT DLL AGF V + GG+ AW +NGL KA
Sbjct: 67 SHFGQSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTKA 119
|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Length = 108 | Back information, alignment and structure |
|---|
| >d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 136 | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Length = 137 | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 120 | Back information, alignment and structure |
|---|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 136 | Back information, alignment and structure |
|---|
| >d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} Length = 135 | Back information, alignment and structure |
|---|
| >d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 157 | Back information, alignment and structure |
|---|
| >d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 154 | Back information, alignment and structure |
|---|
| >d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} Length = 139 | Back information, alignment and structure |
|---|
| >d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} Length = 161 | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 130 | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Length = 144 | Back information, alignment and structure |
|---|
| >d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Length = 101 | Back information, alignment and structure |
|---|
| >d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 132 | Back information, alignment and structure |
|---|
| >d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Length = 147 | Back information, alignment and structure |
|---|
| >d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} Length = 141 | Back information, alignment and structure |
|---|
| >d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 153 | |||
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 99.95 | |
| d1yt8a1 | 136 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.95 | |
| d1gmxa_ | 108 | Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 | 99.94 | |
| d1qxna_ | 137 | Polysulfide-sulfur transferase (sulfide dehydrogen | 99.93 | |
| d1yt8a3 | 157 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.93 | |
| d1yt8a2 | 101 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.92 | |
| d1e0ca2 | 136 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 99.92 | |
| d1urha1 | 147 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 99.92 | |
| d1rhsa1 | 149 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 99.91 | |
| d1e0ca1 | 135 | Sulfurtransferase {Azotobacter vinelandii [TaxId: | 99.91 | |
| d1yt8a4 | 130 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 99.91 | |
| d1uara1 | 143 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 99.91 | |
| d1rhsa2 | 144 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 99.9 | |
| d1t3ka_ | 132 | Dual specificity phosphatase Cdc25 {Thale cress (A | 99.89 | |
| d1uara2 | 141 | Sulfurtransferase {Thermus thermophilus [TaxId: 27 | 99.89 | |
| d1okga1 | 156 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 99.87 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 99.87 | |
| d1okga2 | 139 | 3-mercaptopyruvate sulfurtransferase {Leishmania m | 99.83 | |
| d1c25a_ | 161 | CDC25a {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d1ymka1 | 174 | CDC25b {Human (Homo sapiens) [TaxId: 9606]} | 99.78 | |
| d2gwfa1 | 135 | Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Hum | 99.71 | |
| d1hzma_ | 154 | Erk2 binding domain of Mapk phosphatase mkp-3 {Hum | 99.65 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 96.44 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 94.93 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 92.51 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 92.26 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 91.97 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 90.77 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 89.73 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 88.56 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 87.93 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 87.61 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 87.52 | |
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 86.22 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 86.01 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 85.2 | |
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 84.88 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 82.5 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 81.75 | |
| d1a53a_ | 247 | Indole-3-glycerophosphate synthase, IPGS {Archaeon | 80.65 |
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Rhodanese/Cell cycle control phosphatase superfamily: Rhodanese/Cell cycle control phosphatase family: Single-domain sulfurtransferase domain: Thiosulfate sulfurtransferase/Senescence-associated protein species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Probab=99.95 E-value=8.1e-29 Score=165.28 Aligned_cols=112 Identities=50% Similarity=0.795 Sum_probs=100.3
Q ss_pred ceeecHHHHHHHHhCCCeEEecCChhhhhcCCCCCcceeCccccccCCCCCCCChHHHHHHHhhccCCCeEEEEeCCCcc
Q 031761 28 VITVDVRAAKNLLESGYGYLDVRTAEEFKEGHVDAAKIFNIPYMFNTPEGRVKNPDFLKKVRSLCKEEDRLVVGCQSGAR 107 (153)
Q Consensus 28 ~~~i~~~~~~~~~~~~~~iIDvR~~~e~~~ghi~ga~~i~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~ivi~c~~g~~ 107 (153)
...+++.++.++++++..|||||++.||..|||||| +|+|+...........+++.+.+...++++++||+||++|.|
T Consensus 7 p~~i~~~~a~~l~~~g~~liDvR~~~e~~~ghi~ga--~~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~iv~~C~~G~r 84 (119)
T d1tq1a_ 7 PSSVSVTVAHDLLLAGHRYLDVRTPEEFSQGHACGA--INVPYMNRGASGMSKNTDFLEQVSSHFGQSDNIIVGCQSGGR 84 (119)
T ss_dssp CEEEEHHHHHHHHHHTCCEEEESCHHHHHHCCBTTB--EECCSCCCSTTTCCCTTTHHHHHTTTCCTTSSEEEEESSCSH
T ss_pred CCccCHHHHHHHHHCcCEEEECCCHHHHHcCCCCCc--cchhhcccccccccccHHHHHHHHHhcCCCcEEEEEcCCcCc
Confidence 567899999999988889999999999999999999 999987665555555567878777767899999999999999
Q ss_pred HHHHHHHHHHCCccceeeccccHHHHHhCCCcee
Q 031761 108 SLHATADLLGAGFKHVSNFGGGHMAWVQNGLKVK 141 (153)
Q Consensus 108 a~~~~~~L~~~G~~~v~~l~gG~~~w~~~g~~~~ 141 (153)
|..+++.|.+.||+||++|.||+.+|.++|+|++
T Consensus 85 s~~a~~~L~~~G~~nv~~l~GG~~~W~~~g~P~e 118 (119)
T d1tq1a_ 85 SIKATTDLLHAGFTGVKDIVGGYSAWAKNGLPTK 118 (119)
T ss_dssp HHHHHHHHHHHHCCSEEEEECCHHHHHHHTCCCC
T ss_pred HHHHHHHHHhcccCCeEEecChHHHHHHCCCCcc
Confidence 9999999999999999999999999999999986
|
| >d1yt8a1 c.46.1.2 (A:107-242) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1yt8a2 c.46.1.2 (A:6-106) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1e0ca2 c.46.1.2 (A:136-271) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1urha1 c.46.1.2 (A:2-148) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rhsa1 c.46.1.2 (A:1-149) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e0ca1 c.46.1.2 (A:1-135) Sulfurtransferase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1uara1 c.46.1.2 (A:2-144) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1t3ka_ c.46.1.1 (A:) Dual specificity phosphatase Cdc25 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1uara2 c.46.1.2 (A:145-285) Sulfurtransferase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1okga1 c.46.1.2 (A:7-162) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okga2 c.46.1.2 (A:163-301) 3-mercaptopyruvate sulfurtransferase {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1c25a_ c.46.1.1 (A:) CDC25a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ymka1 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gwfa1 c.46.1.4 (A:181-315) Ubiquitin carboxyl-terminal hydrolase 8, USP8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hzma_ c.46.1.1 (A:) Erk2 binding domain of Mapk phosphatase mkp-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|