Citrus Sinensis ID: 031763
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 153 | ||||||
| 224055123 | 229 | predicted protein [Populus trichocarpa] | 0.973 | 0.650 | 0.562 | 9e-49 | |
| 297736295 | 226 | unnamed protein product [Vitis vinifera] | 0.967 | 0.654 | 0.564 | 7e-47 | |
| 297811065 | 215 | cytochrome b5 domain-containing protein | 0.941 | 0.669 | 0.584 | 7e-45 | |
| 356531661 | 215 | PREDICTED: cytochrome b5 reductase 4-lik | 0.967 | 0.688 | 0.548 | 1e-43 | |
| 359487399 | 285 | PREDICTED: uncharacterized protein LOC10 | 0.816 | 0.438 | 0.657 | 1e-43 | |
| 9758996 | 275 | unnamed protein product [Arabidopsis tha | 0.954 | 0.530 | 0.558 | 2e-43 | |
| 15242486 | 211 | reduced lateral root formation protein [ | 0.954 | 0.691 | 0.558 | 3e-43 | |
| 255645479 | 215 | unknown [Glycine max] | 0.967 | 0.688 | 0.542 | 1e-42 | |
| 356542758 | 215 | PREDICTED: cytochrome b5 reductase 4-lik | 0.967 | 0.688 | 0.531 | 1e-42 | |
| 255553510 | 227 | flavohemoprotein B5/b5r, putative [Ricin | 0.836 | 0.563 | 0.62 | 2e-42 |
| >gi|224055123|ref|XP_002298420.1| predicted protein [Populus trichocarpa] gi|222845678|gb|EEE83225.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 197 bits (502), Expect = 9e-49, Method: Compositional matrix adjust.
Identities = 108/192 (56%), Positives = 131/192 (68%), Gaps = 43/192 (22%)
Query: 1 MNNDNDFTFCKV----------EKNQSSD----------ADGSVENQSSGFLWKQDELPS 40
M+NDNDFTFC+V +N +SD ++G+ +Q G +W+ D LPS
Sbjct: 1 MDNDNDFTFCQVGLPVDKNELEAENLASDIGGIIIKDGFSNGTNSSQGGGVVWR-DSLPS 59
Query: 41 ----KTNKTVGFLSYNVIDASS------------SSAAGTSVK------VASRKPASRAK 78
K +TVG LS+NVIDAS+ S AGTS K V++RKP +R+K
Sbjct: 60 DADSKNERTVGSLSFNVIDASARGESSGVPRQVASGNAGTSAKNFDEKKVSARKPVARSK 119
Query: 79 VPFEKGYSQVDWLRLTQTHPDLAGLKGQSNKRLITMDEVKQHQSEGSMWTVLKGRVYNLS 138
VPFEKGYSQ+DWL+LT+THPDLAGLKGQSNKRLI+MDEVK HQ+EGSMWTVLKGRVYNLS
Sbjct: 120 VPFEKGYSQMDWLKLTRTHPDLAGLKGQSNKRLISMDEVKLHQTEGSMWTVLKGRVYNLS 179
Query: 139 PYMKFHPGGMAI 150
PY+KFHPGG I
Sbjct: 180 PYLKFHPGGADI 191
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297736295|emb|CBI24933.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297811065|ref|XP_002873416.1| cytochrome b5 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319253|gb|EFH49675.1| cytochrome b5 domain-containing protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356531661|ref|XP_003534395.1| PREDICTED: cytochrome b5 reductase 4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359487399|ref|XP_002273562.2| PREDICTED: uncharacterized protein LOC100261983 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|9758996|dbj|BAB09523.1| unnamed protein product [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15242486|ref|NP_196530.1| reduced lateral root formation protein [Arabidopsis thaliana] gi|79327401|ref|NP_001031861.1| reduced lateral root formation protein [Arabidopsis thaliana] gi|7671421|emb|CAB89362.1| putative protein [Arabidopsis thaliana] gi|34146794|gb|AAQ62405.1| At5g09680 [Arabidopsis thaliana] gi|51968362|dbj|BAD42873.1| unknown protein [Arabidopsis thaliana] gi|51969432|dbj|BAD43408.1| unknown protein [Arabidopsis thaliana] gi|332004046|gb|AED91429.1| reduced lateral root formation protein [Arabidopsis thaliana] gi|332004047|gb|AED91430.1| reduced lateral root formation protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|255645479|gb|ACU23235.1| unknown [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356542758|ref|XP_003539832.1| PREDICTED: cytochrome b5 reductase 4-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|255553510|ref|XP_002517796.1| flavohemoprotein B5/b5r, putative [Ricinus communis] gi|223543068|gb|EEF44603.1| flavohemoprotein B5/b5r, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 153 | ||||||
| TAIR|locus:2144811 | 211 | RLF "reduced lateral root form | 0.954 | 0.691 | 0.558 | 2.5e-42 | |
| UNIPROTKB|I3LV78 | 264 | LOC100622980 "Uncharacterized | 0.686 | 0.397 | 0.375 | 4.7e-16 | |
| ZFIN|ZDB-GENE-050522-225 | 527 | cyb5r4 "cytochrome b5 reductas | 0.581 | 0.168 | 0.447 | 1e-15 | |
| UNIPROTKB|Q5ZM68 | 130 | CYB5R4 "Uncharacterized protei | 0.535 | 0.630 | 0.425 | 2.6e-15 | |
| UNIPROTKB|F1MB85 | 520 | CYB5R4 "Cytochrome b5 reductas | 0.588 | 0.173 | 0.422 | 3.5e-15 | |
| UNIPROTKB|Q32LH7 | 520 | CYB5R4 "Cytochrome b5 reductas | 0.588 | 0.173 | 0.422 | 3.5e-15 | |
| UNIPROTKB|Q7L1T6 | 521 | CYB5R4 "Cytochrome b5 reductas | 0.581 | 0.170 | 0.414 | 3.5e-15 | |
| UNIPROTKB|E2R102 | 519 | CYB5R4 "Uncharacterized protei | 0.581 | 0.171 | 0.404 | 4.5e-15 | |
| MGI|MGI:2386848 | 528 | Cyb5r4 "cytochrome b5 reductas | 0.581 | 0.168 | 0.404 | 4.7e-15 | |
| RGD|621834 | 520 | Cyb5r4 "cytochrome b5 reductas | 0.581 | 0.171 | 0.404 | 7.4e-15 |
| TAIR|locus:2144811 RLF "reduced lateral root formation" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 448 (162.8 bits), Expect = 2.5e-42, P = 2.5e-42
Identities = 91/163 (55%), Positives = 117/163 (71%)
Query: 2 NNDNDFTFCKVE------KNQSSDA------DGSVENQSSGFLWKQDELPSKTNKTVGFL 49
+ D+DFTF KV K+ +SD DG + +S+G +WK LP K +T+G L
Sbjct: 4 SRDDDFTFSKVSPPDSEVKDLASDVGSITLKDGLDQQKSNGLIWKDKSLPPK-EETIGSL 62
Query: 50 SYNVIDASSS----SAAGTSVKVASRKPASRAKVPFEKGYSQVDWLRLTQTHPDLAGLKG 105
S+ V D+SSS + + + K +RKP +R KVPFEKGYSQ+DWL+LT+THPDLAGLKG
Sbjct: 63 SFTVTDSSSSKKQSNESSETFKTPARKPITRTKVPFEKGYSQMDWLKLTRTHPDLAGLKG 122
Query: 106 QSNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGM 148
+SNKRLI MDEVK+H++ SMWTVLKGRVYN+SPYM FHPGG+
Sbjct: 123 ESNKRLIPMDEVKKHRTGDSMWTVLKGRVYNISPYMNFHPGGV 165
|
|
| UNIPROTKB|I3LV78 LOC100622980 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050522-225 cyb5r4 "cytochrome b5 reductase 4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZM68 CYB5R4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MB85 CYB5R4 "Cytochrome b5 reductase 4" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32LH7 CYB5R4 "Cytochrome b5 reductase 4" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7L1T6 CYB5R4 "Cytochrome b5 reductase 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R102 CYB5R4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2386848 Cyb5r4 "cytochrome b5 reductase 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|621834 Cyb5r4 "cytochrome b5 reductase 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 153 | |||
| pfam00173 | 74 | pfam00173, Cyt-b5, Cytochrome b5-like Heme/Steroid | 3e-14 | |
| PLN02252 | 888 | PLN02252, PLN02252, nitrate reductase [NADPH] | 4e-11 | |
| COG5274 | 164 | COG5274, CYB5, Cytochrome b involved in lipid meta | 5e-10 | |
| PLN03198 | 526 | PLN03198, PLN03198, delta6-acyl-lipid desaturase; | 0.003 |
| >gnl|CDD|201057 pfam00173, Cyt-b5, Cytochrome b5-like Heme/Steroid binding domain | Back alignment and domain information |
|---|
Score = 63.0 bits (154), Expect = 3e-14
Identities = 16/36 (44%), Positives = 27/36 (75%)
Query: 112 ITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGG 147
T++EVK+H +G W V+ G+VY+++ ++K HPGG
Sbjct: 1 FTLEEVKKHNKDGDCWIVINGKVYDVTRFLKDHPGG 36
|
This family includes heme binding domains from a diverse range of proteins. This family also includes proteins that bind to steroids. The family includes progesterone receptors. Many members of this subfamily are membrane anchored by an N-terminal transmembrane alpha helix. This family also includes a domain in some chitin synthases. There is no known ligand for this domain in the chitin synthases. Length = 74 |
| >gnl|CDD|215141 PLN02252, PLN02252, nitrate reductase [NADPH] | Back alignment and domain information |
|---|
| >gnl|CDD|227599 COG5274, CYB5, Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|178739 PLN03198, PLN03198, delta6-acyl-lipid desaturase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 153 | |||
| KOG0536 | 145 | consensus Flavohemoprotein b5+b5R [Energy producti | 99.94 | |
| KOG0537 | 124 | consensus Cytochrome b5 [Energy production and con | 99.66 | |
| COG5274 | 164 | CYB5 Cytochrome b involved in lipid metabolism [En | 99.62 | |
| PLN02252 | 888 | nitrate reductase [NADPH] | 99.48 | |
| PF00173 | 76 | Cyt-b5: Cytochrome b5-like Heme/Steroid binding do | 99.47 | |
| PLN03198 | 526 | delta6-acyl-lipid desaturase; Provisional | 99.19 | |
| PLN03199 | 485 | delta6-acyl-lipid desaturase-like protein; Provisi | 99.13 | |
| KOG4576 | 167 | consensus Sulfite oxidase, heme-binding component | 98.77 | |
| COG4892 | 81 | Predicted heme/steroid binding protein [General fu | 97.5 | |
| KOG1110 | 183 | consensus Putative steroid membrane receptor Hpr6. | 96.8 | |
| PF14901 | 94 | Jiv90: Cleavage inducing molecular chaperone | 84.3 | |
| KOG1108 | 281 | consensus Predicted heme/steroid binding protein [ | 83.06 |
| >KOG0536 consensus Flavohemoprotein b5+b5R [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=99.94 E-value=1.8e-27 Score=185.24 Aligned_cols=77 Identities=38% Similarity=0.775 Sum_probs=71.4
Q ss_pred CccccccCCCCcChhhHHHhhcCCCCccCCcCCCCCcccCHHHHHhhcCCCCeEEEEcCeEeecCcccccCCCCcccccC
Q 031763 74 ASRAKVPFEKGYSQVDWLRLTQTHPDLAGLKGQSNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGMAISLC 153 (153)
Q Consensus 74 ~~r~KvpL~pG~S~ldW~rL~~s~~~L~g~~~~~~~~~it~eEv~kHn~~~d~WivI~GkVYDVT~Fl~~HPGG~~iLl~ 153 (153)
..|.|++|.||+++|||.+|+.++++|+|.. .+..+|.+||++|++.+||||+|+|+|||||+||+|||||.++||+
T Consensus 35 r~R~K~~l~PG~s~mdW~rL~~s~~~lag~~---~~i~vt~~El~KH~~~dDcW~~i~G~VYnVt~Yl~fHPgG~d~lmk 111 (145)
T KOG0536|consen 35 RKRTKVALAPGHSQMDWSRLTASGKNLAGVE---SPIPVTAEELKKHNKKDDCWIAIRGKVYNVTAYLDFHPGGVDELMK 111 (145)
T ss_pred cccceeecCCCcchhhHHHHhccCccccccc---CCCccCHHHHHhhCCccceEEEEcCEEEecccccccCCCCHHHHHH
Confidence 3399999999999999999999999999874 4567999999999999999999999999999999999999998874
|
|
| >KOG0537 consensus Cytochrome b5 [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG5274 CYB5 Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism] | Back alignment and domain information |
|---|
| >PLN02252 nitrate reductase [NADPH] | Back alignment and domain information |
|---|
| >PF00173 Cyt-b5: Cytochrome b5-like Heme/Steroid binding domain This prints entry is a subset of the Pfam entry; InterPro: IPR001199 Cytochromes b5 are ubiquitous electron transport proteins found in animals, plants and yeasts [] | Back alignment and domain information |
|---|
| >PLN03198 delta6-acyl-lipid desaturase; Provisional | Back alignment and domain information |
|---|
| >PLN03199 delta6-acyl-lipid desaturase-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4576 consensus Sulfite oxidase, heme-binding component [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4892 Predicted heme/steroid binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1110 consensus Putative steroid membrane receptor Hpr6 | Back alignment and domain information |
|---|
| >PF14901 Jiv90: Cleavage inducing molecular chaperone | Back alignment and domain information |
|---|
| >KOG1108 consensus Predicted heme/steroid binding protein [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 153 | ||||
| 3lf5_A | 88 | Structure Of Human Nadh Cytochrome B5 Oxidoreductas | 9e-07 | ||
| 1cxy_A | 90 | Structure And Characterization Of Ectothiorhodospir | 3e-05 | ||
| 1ib7_A | 94 | Solution Structure Of F35y Mutant Of Rat Ferro Cyto | 4e-05 | ||
| 2m33_A | 104 | Solution Nmr Structure Of Full-length Oxidized Micr | 5e-05 | ||
| 2i89_A | 93 | Structure Of Septuple Mutant Of Rat Outer Mitochond | 5e-05 | ||
| 1i87_A | 98 | Solution Structure Of The Water-Soluble Fragment Of | 6e-05 | ||
| 1bfx_A | 99 | The Solution Nmr Structure Of The B Form Of Oxidize | 6e-05 | ||
| 1m2i_A | 82 | Crystal Structure Of E44aE56A MUTANT OF CYTOCHROME | 1e-04 | ||
| 1m2m_A | 82 | Crystal Structure Of E44aE48AE56AD60A MUTANT OF Cyt | 1e-04 | ||
| 1f03_A | 82 | Solution Structure Of Oxidized Bovine Microsomal Cy | 1e-04 | ||
| 1aqa_A | 94 | Solution Structure Of Reduced Microsomal Rat Cytoch | 1e-04 | ||
| 1jex_A | 94 | Solution Structure Of A67v Mutant Of Rat Ferro Cyto | 1e-04 | ||
| 1m20_A | 82 | Crystal Structure Of F35y Mutant Of Trypsin-Solubil | 1e-04 | ||
| 1do9_A | 94 | Solution Structure Of Oxidized Microsomal Rabbit Cy | 1e-04 | ||
| 1blv_A | 94 | Solution Structure Of Oxidized Rat Microsomal Cytoc | 1e-04 | ||
| 1hko_A | 104 | Nmr Structure Of Bovine Cytochrome B5 Length = 104 | 3e-04 | ||
| 1cyo_A | 93 | Bovine Cytochrome B(5) Length = 93 | 3e-04 | ||
| 2i96_A | 108 | Solution Structure Of The Oxidized Microsomal Human | 3e-04 | ||
| 1ehb_A | 82 | Crystal Structure Of Recombinant Trypsin-Solubilize | 4e-04 | ||
| 1es1_A | 82 | Crystal Structure Of Val61his Mutant Of Trypsin-Sol | 4e-04 | ||
| 1u9u_A | 82 | Crystal Structure Of F58y Mutant Of Cytochrome B5 L | 4e-04 | ||
| 1i5u_A | 82 | Solution Structure Of Cytochrome B5 Triple Mutant ( | 4e-04 | ||
| 1j0q_A | 82 | Solution Structure Of Oxidized Bovine Microsomal Cy | 4e-04 | ||
| 1u9m_A | 82 | Crystal Structure Of F58w Mutant Of Cytochrome B5 L | 4e-04 | ||
| 1lqx_A | 82 | Crystal Structure Of V45e Mutant Of Cytochrome B5 L | 5e-04 | ||
| 1lr6_A | 82 | Crystal Structure Of V45y Mutant Of Cytochrome B5 L | 5e-04 | ||
| 1sh4_A | 82 | Solution Structure Of Oxidized Bovine Microsomal Cy | 5e-04 | ||
| 3ner_A | 92 | Structure Of Human Type B Cytochrome B5 Length = 92 | 8e-04 |
| >pdb|3LF5|A Chain A, Structure Of Human Nadh Cytochrome B5 Oxidoreductase (Ncb5or) B5 Domain To 1.25a Resolution Length = 88 | Back alignment and structure |
|
| >pdb|1CXY|A Chain A, Structure And Characterization Of Ectothiorhodospira Vacuolata Cytochrome B558, A Prokaryotic Homologue Of Cytochrome B5 Length = 90 | Back alignment and structure |
| >pdb|2M33|A Chain A, Solution Nmr Structure Of Full-length Oxidized Microsomal Rabbit Cytochrome B5 Length = 104 | Back alignment and structure |
| >pdb|2I89|A Chain A, Structure Of Septuple Mutant Of Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 93 | Back alignment and structure |
| >pdb|1I87|A Chain A, Solution Structure Of The Water-Soluble Fragment Of Rat Hepatic Apocytochrome B5 Length = 98 | Back alignment and structure |
| >pdb|1BFX|A Chain A, The Solution Nmr Structure Of The B Form Of Oxidized Rat Microsomal Cytochrome B5, Minimized Average Structure Length = 99 | Back alignment and structure |
| >pdb|1M2I|A Chain A, Crystal Structure Of E44aE56A MUTANT OF CYTOCHROME B5 Length = 82 | Back alignment and structure |
| >pdb|1M2M|A Chain A, Crystal Structure Of E44aE48AE56AD60A MUTANT OF Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1F03|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant (E44a, E48a, E56a, D60a) And Its Interaction With Cytochrome C Length = 82 | Back alignment and structure |
| >pdb|1AQA|A Chain A, Solution Structure Of Reduced Microsomal Rat Cytochrome B5, Nmr, Minimized Average Structure Length = 94 | Back alignment and structure |
| >pdb|1JEX|A Chain A, Solution Structure Of A67v Mutant Of Rat Ferro Cytochrome B5 Length = 94 | Back alignment and structure |
| >pdb|1M20|A Chain A, Crystal Structure Of F35y Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1DO9|A Chain A, Solution Structure Of Oxidized Microsomal Rabbit Cytochrome B5. Factors Determining The Heterogeneous Binding Of The Heme Length = 94 | Back alignment and structure |
| >pdb|1BLV|A Chain A, Solution Structure Of Oxidized Rat Microsomal Cytochrome B5 In The Presence Of 2 M Guanidinium Chloride: Monitoring The Early Steps In Protein Unfolding Length = 94 | Back alignment and structure |
| >pdb|1HKO|A Chain A, Nmr Structure Of Bovine Cytochrome B5 Length = 104 | Back alignment and structure |
| >pdb|1CYO|A Chain A, Bovine Cytochrome B(5) Length = 93 | Back alignment and structure |
| >pdb|2I96|A Chain A, Solution Structure Of The Oxidized Microsomal Human Cytochrome B5 Length = 108 | Back alignment and structure |
| >pdb|1EHB|A Chain A, Crystal Structure Of Recombinant Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1ES1|A Chain A, Crystal Structure Of Val61his Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1U9U|A Chain A, Crystal Structure Of F58y Mutant Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1I5U|A Chain A, Solution Structure Of Cytochrome B5 Triple Mutant (E48aE56AD60A) Length = 82 | Back alignment and structure |
| >pdb|1J0Q|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant V61h Length = 82 | Back alignment and structure |
| >pdb|1U9M|A Chain A, Crystal Structure Of F58w Mutant Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1LQX|A Chain A, Crystal Structure Of V45e Mutant Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1LR6|A Chain A, Crystal Structure Of V45y Mutant Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1SH4|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant V45h Length = 82 | Back alignment and structure |
| >pdb|3NER|A Chain A, Structure Of Human Type B Cytochrome B5 Length = 92 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 153 | |||
| 3lf5_A | 88 | Cytochrome B5 reductase 4; NCB5OR, electron transf | 5e-16 | |
| 2keo_A | 112 | Probable E3 ubiquitin-protein ligase HERC2; protei | 1e-15 | |
| 1x3x_A | 82 | Cytochrome B5; hemoprotein, porcine parasitic nama | 8e-15 | |
| 3ner_A | 92 | Cytochrome B5 type B; heme, electron transport; HE | 2e-14 | |
| 1cxy_A | 90 | Cytochrome B5; helix, beta-strand, electron transp | 2e-14 | |
| 2ibj_A | 88 | Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY dif | 4e-14 | |
| 1cyo_A | 93 | Cytochrome B5; electron transport; HET: HEM; 1.50A | 6e-14 | |
| 1hko_A | 104 | Cytochrome B5; electron transfer protein, heme, el | 8e-14 | |
| 1mj4_A | 82 | Sulfite oxidase; cytochrome B5, heme, oxidoreducta | 2e-12 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 5e-10 | |
| 1sox_A | 466 | Sulfite oxidase; oxidoreductase, sulfite oxidation | 9e-08 |
| >3lf5_A Cytochrome B5 reductase 4; NCB5OR, electron transfer, redox, heme, endoplasmic reticulu flavoprotein, iron, metal-binding, NAD, oxidoreductase; HET: HEM; 1.25A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
Score = 67.7 bits (166), Expect = 5e-16
Identities = 17/45 (37%), Positives = 28/45 (62%)
Query: 106 QSNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGMAI 150
+ +T +E+K+H + W ++G VYN+SPYM++HPGG
Sbjct: 2 KGRLIEVTEEELKKHNKKDDCWICIRGFVYNVSPYMEYHPGGEDE 46
|
| >2keo_A Probable E3 ubiquitin-protein ligase HERC2; protein of unknown function, HERC2 cytochrome domain, ligase binding, phosphoprotein; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1x3x_A Cytochrome B5; hemoprotein, porcine parasitic namatode, electron transport; HET: HEM; 1.80A {Ascaris suum} Length = 82 | Back alignment and structure |
|---|
| >3ner_A Cytochrome B5 type B; heme, electron transport; HET: HEM; 1.45A {Homo sapiens} PDB: 1awp_A* 3mus_A* 1b5m_A* 1eue_A* 1icc_A* 1lj0_A* 2i89_A* Length = 92 | Back alignment and structure |
|---|
| >1cxy_A Cytochrome B5; helix, beta-strand, electron transport; HET: HEM; 1.65A {Ectothiorhodospira shaposhnikovii} SCOP: d.120.1.1 Length = 90 | Back alignment and structure |
|---|
| >2ibj_A Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY diffraction, heme, electron transport; HET: HEM; 1.55A {Musca domestica} Length = 88 | Back alignment and structure |
|---|
| >1cyo_A Cytochrome B5; electron transport; HET: HEM; 1.50A {Bos taurus} SCOP: d.120.1.1 PDB: 1bfx_A* 1i87_A 1i8c_A 1iet_A 1ieu_A 1do9_A* 1aqa_A* 1aw3_A* 1axx_A* 1b5a_A* 1b5b_A* 1blv_A* 1mny_A* 2axx_A* 1ib7_A* 1jex_A* 1ehb_A* 1nx7_A* 1u9u_A* 1m20_A* ... Length = 93 | Back alignment and structure |
|---|
| >1hko_A Cytochrome B5; electron transfer protein, heme, electron transport; HET: HEM; NMR {Bos taurus} SCOP: d.120.1.1 PDB: 2i96_A* Length = 104 | Back alignment and structure |
|---|
| >1mj4_A Sulfite oxidase; cytochrome B5, heme, oxidoreductase; HET: HEM; 1.20A {Homo sapiens} SCOP: d.120.1.1 Length = 82 | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Length = 511 | Back alignment and structure |
|---|
| >1sox_A Sulfite oxidase; oxidoreductase, sulfite oxidation; HET: MTE HEM EPE; 1.90A {Gallus gallus} SCOP: b.1.18.6 d.120.1.1 d.176.1.1 PDB: 3hc2_A* 3hbq_A* 3hbg_A* 3hbp_A* 3r18_A* 3r19_A* Length = 466 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 153 | |||
| 3ner_A | 92 | Cytochrome B5 type B; heme, electron transport; HE | 99.63 | |
| 1mj4_A | 82 | Sulfite oxidase; cytochrome B5, heme, oxidoreducta | 99.63 | |
| 1cxy_A | 90 | Cytochrome B5; helix, beta-strand, electron transp | 99.63 | |
| 1cyo_A | 93 | Cytochrome B5; electron transport; HET: HEM; 1.50A | 99.62 | |
| 2ibj_A | 88 | Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY dif | 99.62 | |
| 3lf5_A | 88 | Cytochrome B5 reductase 4; NCB5OR, electron transf | 99.61 | |
| 1x3x_A | 82 | Cytochrome B5; hemoprotein, porcine parasitic nama | 99.61 | |
| 1hko_A | 104 | Cytochrome B5; electron transfer protein, heme, el | 99.6 | |
| 2keo_A | 112 | Probable E3 ubiquitin-protein ligase HERC2; protei | 99.55 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 99.34 | |
| 1j03_A | 102 | Putative steroid binding protein; alpha and beta, | 99.3 |
| >3ner_A Cytochrome B5 type B; heme, electron transport; HET: HEM; 1.45A {Homo sapiens} SCOP: d.120.1.1 PDB: 1awp_A* 3mus_A* 1b5m_A* 1eue_A* 1icc_A* 1lj0_A* 2i89_A* | Back alignment and structure |
|---|
Probab=99.63 E-value=1.1e-16 Score=115.17 Aligned_cols=46 Identities=30% Similarity=0.704 Sum_probs=43.0
Q ss_pred CCCcccCHHHHHhhcCCCCeEEEEcCeEeecCcccccCCCCccccc
Q 031763 107 SNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGMAISL 152 (153)
Q Consensus 107 ~~~~~it~eEv~kHn~~~d~WivI~GkVYDVT~Fl~~HPGG~~iLl 152 (153)
+.++.||++||++|++.++|||+|+|+|||||+|+..||||.++|+
T Consensus 7 ~~~~~~t~~Ev~~h~~~~~~wv~i~g~VYDvT~f~~~HPGG~~~l~ 52 (92)
T 3ner_A 7 TSVTYYRLEEVAKRNSLKELWLVIHGRVYDVTRFLNEHPGGEEVLL 52 (92)
T ss_dssp CCSCEECHHHHTTCEETTEEEEEETTEEEECGGGTTTCTTCSHHHH
T ss_pred CCCCeeCHHHHHhhCCCCCEEEEECCEEEEcccccccCCCHHHHHH
Confidence 4568899999999999999999999999999999999999998765
|
| >1mj4_A Sulfite oxidase; cytochrome B5, heme, oxidoreductase; HET: HEM; 1.20A {Homo sapiens} SCOP: d.120.1.1 | Back alignment and structure |
|---|
| >1cxy_A Cytochrome B5; helix, beta-strand, electron transport; HET: HEM; 1.65A {Ectothiorhodospira shaposhnikovii} SCOP: d.120.1.1 | Back alignment and structure |
|---|
| >1cyo_A Cytochrome B5; electron transport; HET: HEM; 1.50A {Bos taurus} SCOP: d.120.1.1 PDB: 1bfx_A* 1i87_A 1i8c_A 1iet_A 1ieu_A 1do9_A* 1aqa_A* 1aw3_A* 1axx_A* 1b5a_A* 1b5b_A* 1blv_A* 1mny_A* 2axx_A* 1ib7_A* 1jex_A* 1ehb_A* 1nx7_A* 1u9u_A* 1m20_A* ... | Back alignment and structure |
|---|
| >2ibj_A Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY diffraction, heme, electron transport; HET: HEM; 1.55A {Musca domestica} | Back alignment and structure |
|---|
| >3lf5_A Cytochrome B5 reductase 4; NCB5OR, electron transfer, redox, heme, endoplasmic reticulu flavoprotein, iron, metal-binding, NAD, oxidoreductase; HET: HEM; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1x3x_A Cytochrome B5; hemoprotein, porcine parasitic namatode, electron transport; HET: HEM; 1.80A {Ascaris suum} | Back alignment and structure |
|---|
| >1hko_A Cytochrome B5; electron transfer protein, heme, electron transport; HET: HEM; NMR {Bos taurus} SCOP: d.120.1.1 PDB: 2i96_A* | Back alignment and structure |
|---|
| >2keo_A Probable E3 ubiquitin-protein ligase HERC2; protein of unknown function, HERC2 cytochrome domain, ligase binding, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* | Back alignment and structure |
|---|
| >1j03_A Putative steroid binding protein; alpha and beta, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.120.1.2 PDB: 1t0g_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 153 | ||||
| d1kbia2 | 97 | d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal | 6e-12 | |
| d1cxya_ | 81 | d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira | 6e-12 | |
| d1euea_ | 86 | d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegic | 2e-10 | |
| d1cyoa_ | 88 | d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [Ta | 7e-10 | |
| d1mj4a_ | 80 | d.120.1.1 (A:) Sulfite oxidase, N-terminal domain | 7e-09 | |
| d1soxa2 | 91 | d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal dom | 4e-08 |
| >d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cytochrome b5-like heme/steroid binding domain superfamily: Cytochrome b5-like heme/steroid binding domain family: Cytochrome b5 domain: Flavocytochrome b2, N-terminal domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 56.5 bits (136), Expect = 6e-12
Identities = 17/47 (36%), Positives = 26/47 (55%)
Query: 104 KGQSNKRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGMAI 150
K NK+ I+ EV +H W V+ G VY+L+ ++ HPGG +
Sbjct: 3 KLDMNKQKISPAEVAKHNKPDDCWVVINGYVYDLTRFLPNHPGGQDV 49
|
| >d1cxya_ d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira vacuolata [TaxId: 1054]} Length = 81 | Back information, alignment and structure |
|---|
| >d1euea_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1cyoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} Length = 88 | Back information, alignment and structure |
|---|
| >d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 153 | |||
| d1cxya_ | 81 | Cytochrome b558 {Ectothiorhodospira vacuolata [Tax | 99.73 | |
| d1euea_ | 86 | Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 101 | 99.69 | |
| d1cyoa_ | 88 | Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} | 99.68 | |
| d1soxa2 | 91 | Sulfite oxidase, N-terminal domain {Chicken (Gallu | 99.68 | |
| d1kbia2 | 97 | Flavocytochrome b2, N-terminal domain {Baker's yea | 99.66 | |
| d1mj4a_ | 80 | Sulfite oxidase, N-terminal domain {Human (Homo sa | 99.63 | |
| d1t0ga_ | 109 | Putative steroid binding protein AT2G24940 {Thale | 97.77 |
| >d1cxya_ d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira vacuolata [TaxId: 1054]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cytochrome b5-like heme/steroid binding domain superfamily: Cytochrome b5-like heme/steroid binding domain family: Cytochrome b5 domain: Cytochrome b558 species: Ectothiorhodospira vacuolata [TaxId: 1054]
Probab=99.73 E-value=7.4e-19 Score=121.60 Aligned_cols=44 Identities=34% Similarity=0.795 Sum_probs=42.2
Q ss_pred CcccCHHHHHhhcCCCCeEEEEcCeEeecCcccccCCCCccccc
Q 031763 109 KRLITMDEVKQHQSEGSMWTVLKGRVYNLSPYMKFHPGGMAISL 152 (153)
Q Consensus 109 ~~~it~eEv~kHn~~~d~WivI~GkVYDVT~Fl~~HPGG~~iLl 152 (153)
++.||++||++|++++||||+|+|+|||||+|+..||||.++|+
T Consensus 2 lp~~t~~ev~~H~~~~d~Wivi~g~VYDvT~f~~~HPGG~~~l~ 45 (81)
T d1cxya_ 2 LPVFTLEQVAEHHSPDDCWMAIHGKVYDLTPYVPNHPGPAGMML 45 (81)
T ss_dssp CCBCCHHHHTTCEETTEEEEEETTEEEECTTTGGGCCSSTTTTG
T ss_pred cCccCHHHHHhhCCCCCEEEEECCEEEeccceeecCCCcHHHHH
Confidence 57899999999999999999999999999999999999998886
|
| >d1euea_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1cyoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t0ga_ d.120.1.2 (A:) Putative steroid binding protein AT2G24940 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|