Citrus Sinensis ID: 031777

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---

MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYIESYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKVYLLLYTGIFFFYPSP

ccccccEEEEEEEEccccccHHHHHHHHccccccccccEEEcEEEEEEEEEEccEEEEEEEEEcccccHHHHHHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccHHHHHHHHHHccccEEEEccc

*NPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYIESYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKVYLLLYTGIFFFYPSP

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYIESYISTIGVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIIVYDVTDQESFNNVKQWLNEIDRYASDNVNKLLVGNKCDLTANKVVSYETAKVYLLLYTGIFFFYPSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ras-related protein Rab-1A	Probably required for transit of protein from the ER through Golgi compartment. Binds GTP and GDP and possesses intrinsic GTPase activity.	confident	Q6NYB7
Ras-related protein RABD2b	Protein transport. Regulator of membrane traffic from the Golgi apparatus towards the endoplasmic reticulum (ER).	confident	Q9FPJ4
Ras-related protein Rab-1A	Probably required for transit of protein from the ER through Golgi compartment. Binds GTP and GDP and possesses intrinsic GTPase activity.	confident	P62820

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TKL, chain A
Confidence level:very confident
Coverage over the Query: 3-153
View the alignment between query and template
View the model in PyMOL