BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 031784
(153 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q66613|GB_EHV2 Envelope glycoprotein B OS=Equine herpesvirus 2 (strain 86/87) GN=8
PE=3 SV=1
Length = 874
Score = 30.0 bits (66), Expect = 5.8, Method: Composition-based stats.
Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 2/55 (3%)
Query: 60 ARSVLRSTATPRAAVSGRLAAGIKPKAAPTSSPFRMPKQNPLSQRLFRSPVELSC 114
A+ V+ T TP A + A P A PFR+ +P +FR P+E SC
Sbjct: 25 AQEVVAETTTPFATHRPEVVAEENP--ANPFLPFRVCGASPTGGEIFRFPLEESC 77
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.315 0.125 0.358
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 50,023,635
Number of Sequences: 539616
Number of extensions: 1622937
Number of successful extensions: 5242
Number of sequences better than 100.0: 32
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 27
Number of HSP's that attempted gapping in prelim test: 5217
Number of HSP's gapped (non-prelim): 49
length of query: 153
length of database: 191,569,459
effective HSP length: 107
effective length of query: 46
effective length of database: 133,830,547
effective search space: 6156205162
effective search space used: 6156205162
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 56 (26.2 bits)