Query         031784
Match_columns 153
No_of_seqs    98 out of 114
Neff          2.5 
Searched_HMMs 46136
Date          Fri Mar 29 05:18:00 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031784.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/031784hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF14412 AHH:  A nuclease famil  16.8      70  0.0015   22.6   0.9   19   20-39     40-58  (109)
  2 PF11401 Tetrabrachion:  Tetrab  16.3     3.9 8.5E-05   27.8  -5.2   23   13-35      9-31  (49)
  3 PF09794 Avl9:  Transport prote  14.6      70  0.0015   28.9   0.6   20    1-21     93-112 (379)
  4 PF11135 DUF2888:  Protein of u  10.4 1.7E+02  0.0037   23.7   1.6   29    4-32     78-106 (144)
  5 PF09984 DUF2222:  Uncharacteri   9.0   3E+02  0.0066   21.7   2.4   34    8-43     94-127 (146)
  6 PF02531 PsaD:  PsaD;  InterPro   8.7 2.3E+02   0.005   23.1   1.7   33   14-46     40-72  (139)
  7 CHL00145 psaD photosystem I su   8.6 1.2E+02  0.0027   24.6   0.1   25   13-37     39-63  (139)
  8 PF01834 XRCC1_N:  XRCC1 N term   8.4 2.2E+02  0.0048   23.2   1.5   24    7-34      4-27  (153)
  9 PF15249 GLTSCR1:  Glioma tumor   7.6 1.5E+02  0.0033   21.8   0.2   10  115-124    27-36  (109)
 10 PF08094 Toxin_24:  Conotoxin T   7.4 1.9E+02  0.0042   18.4   0.6    8    2-9      20-27  (33)

No 1  
>PF14412 AHH:  A nuclease family of the HNH/ENDO VII superfamily with conserved AHH
Probab=16.81  E-value=70  Score=22.62  Aligned_cols=19  Identities=37%  Similarity=0.515  Sum_probs=15.8

Q ss_pred             eeecccccccceeeccCCCc
Q 031784           20 ISYDSIHSAENLLYLKNPTK   39 (153)
Q Consensus        20 ~~~~~~~~~~~~~~~~~~~~   39 (153)
                      +-|| |+.++|++||.+..+
T Consensus        40 ~g~~-in~~~Ngv~Lp~~~~   58 (109)
T PF14412_consen   40 YGID-INDPENGVWLPNSEK   58 (109)
T ss_pred             cCCC-cCCccceeeeeccCC
Confidence            3467 999999999987766


No 2  
>PF11401 Tetrabrachion:  Tetrabrachion;  InterPro: IPR021535  Tetrabrachion forms a parallel right-handed coiled coil structure with hydrophobic interactions and salt bridges forming a thermostable tetrameric structure. It contains large hydrophobic cavities. No function is known for this family of proteins []. ; PDB: 1FE6_C 1YBK_A.
Probab=16.34  E-value=3.9  Score=27.77  Aligned_cols=23  Identities=48%  Similarity=0.691  Sum_probs=19.0

Q ss_pred             EEEeeeeeeecccccccceeecc
Q 031784           13 VVYRLPVISYDSIHSAENLLYLK   35 (153)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~~   35 (153)
                      +||||-||--|-..|..||+-|.
T Consensus         9 ivyrltviiddryeslknlitlr   31 (49)
T PF11401_consen    9 IVYRLTVIIDDRYESLKNLITLR   31 (49)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             eeEEEEEEEccHHHHHHHHHhhh
Confidence            57999999988888888887654


No 3  
>PF09794 Avl9:  Transport protein Avl9;  InterPro: IPR018307 This entry represents the late secretory protein Avl9, which is required for the generation of secretory vesicles as well as for actin polarization and polarized growth. Avl9 is involved in exocytic transport from the Golgi. It has been speculated that Avl9 could play a role in deforming membranes for vesicle fission and/or in recruiting cargo [].
Probab=14.64  E-value=70  Score=28.93  Aligned_cols=20  Identities=55%  Similarity=0.730  Sum_probs=16.6

Q ss_pred             CCCCCCcccceEEEEeeeeee
Q 031784            1 MTRGTPQKLSTVVVYRLPVIS   21 (153)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~   21 (153)
                      +|||+-|| +-||+-|+|+..
T Consensus        93 vtRs~vQK-sVvViS~~P~fg  112 (379)
T PF09794_consen   93 VTRSTVQK-SVVVISRLPFFG  112 (379)
T ss_pred             ccchheEE-EEEEEECCCcHH
Confidence            58999999 678889999653


No 4  
>PF11135 DUF2888:  Protein of unknown function (DUF2888);  InterPro: IPR022600 This entry is represented by Frog virus 3, Orf82R; it is a family of uncharacterised Ranaviral proteins, a number of which are annotated as immediate early protein ICP-18.
Probab=10.43  E-value=1.7e+02  Score=23.69  Aligned_cols=29  Identities=38%  Similarity=0.346  Sum_probs=24.0

Q ss_pred             CCCcccceEEEEeeeeeeeccccccccee
Q 031784            4 GTPQKLSTVVVYRLPVISYDSIHSAENLL   32 (153)
Q Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   32 (153)
                      .|||-|+..+.-||--|.+|+-..-||+-
T Consensus        78 ~tpq~ls~~~y~rlhpv~~~~g~~~~~~e  106 (144)
T PF11135_consen   78 DTPQVLSLFFYKRLHPVEWHSGCDYENLE  106 (144)
T ss_pred             CCcceEEeEeeeccccccccCccccccee
Confidence            48999999888899889998877777753


No 5  
>PF09984 DUF2222:  Uncharacterized signal transduction histidine kinase domain (DUF2222);  InterPro: IPR019247 This entry is found at the N terminus of various BarA-like signal transduction histidine kinases. These proteins are involved in the regulation of carbon metabolism via the csrA/csrB regulatory system. The role of this domain has not, as yet, been established. ; GO: 0004673 protein histidine kinase activity
Probab=8.96  E-value=3e+02  Score=21.72  Aligned_cols=34  Identities=21%  Similarity=0.338  Sum_probs=23.0

Q ss_pred             ccceEEEEeeeeeeecccccccceeeccCCCccccc
Q 031784            8 KLSTVVVYRLPVISYDSIHSAENLLYLKNPTKTLGV   43 (153)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   43 (153)
                      +....+++|.|||+-+..  .++....+.+.+.||.
T Consensus        94 ~~~d~lilr~PI~~e~~~--~~~~~~~~~~~~~LGy  127 (146)
T PF09984_consen   94 HSGDSLILRTPIISESNF--ESDQATAKSQQQPLGY  127 (146)
T ss_pred             ecCCEEEEEcceecCCcC--cCcccccCcCCCcceE
Confidence            344568999999987633  4445556666777774


No 6  
>PF02531 PsaD:  PsaD;  InterPro: IPR003685 PsaD is a small, extrinsic polypeptide located on the stromal side (cytoplasmic side in cyanobacteria) of the photosystem I reaction centre complex. It is required for native assembly of PSI reaction clusters and is implicated in the electrostatic binding of ferredoxin within the reaction centre []. PsaD forms a dimer in solution which is bound by PsaE however PsaD is monomeric in its native complexed PSI environment [].; GO: 0015979 photosynthesis, 0009522 photosystem I, 0009538 photosystem I reaction center; PDB: 2WSF_D 2O01_D 2WSC_D 2WSE_D 1JB0_D 3PCQ_D.
Probab=8.67  E-value=2.3e+02  Score=23.07  Aligned_cols=33  Identities=30%  Similarity=0.506  Sum_probs=22.1

Q ss_pred             EEeeeeeeecccccccceeeccCCCcccccccc
Q 031784           14 VYRLPVISYDSIHSAENLLYLKNPTKTLGVREQ   46 (153)
Q Consensus        14 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   46 (153)
                      ||-+|.=--.-.+.-||||||---..-|..-.|
T Consensus        40 vFEmPTGGAA~M~~G~NLlylARKEQclALgtQ   72 (139)
T PF02531_consen   40 VFEMPTGGAAIMREGENLLYLARKEQCLALGTQ   72 (139)
T ss_dssp             EEETTTTCEEEE-SCCEEEEESSCCCCCCCCCC
T ss_pred             eEeccCchhHhhhcCchhhhhHHHHHHHHHHHH
Confidence            566676666667889999999766555554444


No 7  
>CHL00145 psaD photosystem I subunit II; Validated
Probab=8.58  E-value=1.2e+02  Score=24.62  Aligned_cols=25  Identities=28%  Similarity=0.535  Sum_probs=17.9

Q ss_pred             EEEeeeeeeecccccccceeeccCC
Q 031784           13 VVYRLPVISYDSIHSAENLLYLKNP   37 (153)
Q Consensus        13 ~~~~~~~~~~~~~~~~~~~~~~~~~   37 (153)
                      -||-+|.=--.-.+.-||||||---
T Consensus        39 qvFEmPTGGAA~M~~G~NLlylARK   63 (139)
T CHL00145         39 QIFEMPTGGAAIMRNGENLLYLARK   63 (139)
T ss_pred             ceeecCCchhhhhhcCchhhhhhHH
Confidence            3566676666667889999998543


No 8  
>PF01834 XRCC1_N:  XRCC1 N terminal domain;  InterPro: IPR002706 DNA-repair protein Xrcc1 functions in the repair of single-strand DNA breaks in mammalian cells and forms a repair complex with beta-Pol, ligase III and PARP []. The NMR solution structure of the Xrcc1 N-terminal domain (Xrcc1 NTD) shows that the structural core is a beta-sandwich with beta-strands connected by loops, three helices and two short two-stranded beta-sheets at each connection side. The Xrcc1 NTD specifically binds single-strand break DNA (gapped and nicked) and a gapped DNA-beta-Pol complex [].; GO: 0003684 damaged DNA binding, 0000012 single strand break repair, 0005634 nucleus; PDB: 3K77_E 3K75_C 3LQC_A 1XNA_A 1XNT_A.
Probab=8.44  E-value=2.2e+02  Score=23.17  Aligned_cols=24  Identities=50%  Similarity=0.583  Sum_probs=16.1

Q ss_pred             cccceEEEEeeeeeeecccccccceeec
Q 031784            7 QKLSTVVVYRLPVISYDSIHSAENLLYL   34 (153)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~   34 (153)
                      -|+..||-+    =|-|..|-|||||--
T Consensus         4 ik~k~VvS~----SSed~~~~A~NLL~~   27 (153)
T PF01834_consen    4 IKLKHVVSF----SSEDPVHPAENLLKS   27 (153)
T ss_dssp             CGEEEEEEE----SSS-SSSHGGGGSCG
T ss_pred             ceeeEEEEE----eCCCCCCchhhccCc
Confidence            355555543    477899999999953


No 9  
>PF15249 GLTSCR1:  Glioma tumor suppressor candidate region
Probab=7.58  E-value=1.5e+02  Score=21.78  Aligned_cols=10  Identities=50%  Similarity=1.092  Sum_probs=8.5

Q ss_pred             hhhcccchhh
Q 031784          115 CVETMLPFHT  124 (153)
Q Consensus       115 cveSLLPLHS  124 (153)
                      .++-|||||-
T Consensus        27 A~~RLLPYHv   36 (109)
T PF15249_consen   27 AVERLLPYHV   36 (109)
T ss_pred             HHHHhcchhh
Confidence            4889999995


No 10 
>PF08094 Toxin_24:  Conotoxin TVIIA/GS family;  InterPro: IPR012629 This family consists of conotoxins isolated from the venom of cone snail Conus tulipa and Conus geographus. Conotoxin TVIIA, isolated from Conus tulipa displays little sequence homology with other well-characterised pharmacological classes of peptides, but displays similarity with conotoxin GS, a peptide from Conus geographus. Both these peptides block skeletal muscle sodium channels and also share several biochemical features and represent a distinct subgroup of the four-loop conotoxins [].; GO: 0019871 sodium channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region; PDB: 1AG7_A 1EYO_A.
Probab=7.44  E-value=1.9e+02  Score=18.36  Aligned_cols=8  Identities=63%  Similarity=0.945  Sum_probs=4.4

Q ss_pred             CCCCCccc
Q 031784            2 TRGTPQKL    9 (153)
Q Consensus         2 ~~~~~~~~    9 (153)
                      .||.|||-
T Consensus        20 ~rgnpqkc   27 (33)
T PF08094_consen   20 GRGNPQKC   27 (33)
T ss_dssp             CSSSS-CE
T ss_pred             cCCCcccc
Confidence            36777773


Done!