Citrus Sinensis ID: 031791

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---

MAANNSNGANYLGSMDEVRKVFNKFDKNGDGKISADELKDVLRSLGSKTSPEEVKRVMDEIDTDGDGYIDFKEFSTFHLAGGSTDGTKELKDAFDLYDMDQNGLISANELHAVLKKLGEKSSLKDCVNMIKKVDADGDGHVNFEEFKKMMTRS

cccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHccccccHHHHHHHHHHHccccccCEcHHHHHHHHHcccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHccc

******************RKVFNKFDKNGDGKISADELKDVLRSLGSKTSPEEVKRVMDEIDTDGDGYIDFKEFSTFHLAGGSTDGTKELKDAFDLYDMDQNGLISANELHAVLKKLGEKSSLKDCVNMIKKVDADGDGHVNFEEFKKMMTRS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAANNSNGANYLGSMDEVRKVFNKFDKNGDGKISADELKDVLRSLGSKTSPEEVKRVMDEIDTDGDGYIDFKEFSTFHLAGGSTDGTKELKDAFDLYDMDQNGLISANELHAVLKKLGEKSSLKDCVNMIKKVDADGDGHVNFEEFKKMMTRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable calcium-binding protein CML18	Potential calcium sensor.	probable	Q0DJV6
Probable calcium-binding protein CML23	Potential calcium sensor.	probable	Q9C8Y1
Calmodulin	Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases. Together with CEP110 and centrin, is involved in a genetic pathway that regulates the centrosome cycle and progression through cytokinesis.	probable	P62204

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SG6, chain A
Confidence level:very confident
Coverage over the Query: 8-151
View the alignment between query and template
View the model in PyMOL