Citrus Sinensis ID: 031801

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---

MIVGILDNQVWSLVRRFDQPQKYKPFVSRCIVQGDLQIGSVREVNVKSGLPATTSTERLELLDDEEHIFGMRIVGGDHRLKNYSSIVTVHPEVIDGRPGTLVIESFVVDVPDGNTKDETCYFVEALIKCNLKSLADVSEHLAVQDRTEPIDRI

cEEcccHHHHHHHHccccccccccccEEEEEEEccccccEEEEEEEEcccccccCEEEEEcccccccEEEEEEEccccccCEEEEEEEEEEEECcccccEEEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc

MIVGILDNQVWSLVRRFDQPQKYKPFVSRCIVQGDLQIGSVREVNVKSGLPATTSTERLELLDDEEHIFGMRIVGGDHRLKNYSSIVTVHPEVIDGRPGTLVIESFVVDVPDGNTKDETCYFVEALIKCNLKSLADVSEH*************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MIVGILDNQVWSLVRRFDQPQKYKPFVSRCIVQGDLQIGSVREVNVKSGLPATTSTERLELLDDEEHIFGMRIVGGDHRLKNYSSIVTVHPEVIDGRPGTLVIESFVVDVPDGNTKDETCYFVEALIKCNLKSLADVSEHLAVQDRTEPIDRI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Abscisic acid receptor PYL9	Receptor for abscisic acid (ABA) required for ABA-mediated responses such as stomatal closure and germination inhibition. Inhibits the activity of group-A protein phosphatases type 2C (PP2Cs) when activated by ABA. Confers enhanced sensitivity to ABA.	probable	Q84MC7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OQU, chain A
Confidence level:very confident
Coverage over the Query: 2-145
View the alignment between query and template
View the model in PyMOL