Citrus Sinensis ID: 031807


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MGAGPKSDVPTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAGDGSRQPSELELAQAFHQGKYFAGITKKLKGSA
cccccccccccccHHHHHHccEEEEcccccccccHHHHHHHHHHHccHHHcccccccccEEEEEcccccccHHHHHHHHHHHHHHHccEEEcccccccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccc
*****KSDVPTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFA******P**LELAQAFHQGKYFAGITKKLKG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGAGPKSDVPTITPNELAEADGILLGFPTRFGMMAAQFKAFLDATGGLWRSQQLAGKPAGIFYSTGSQGGGQETTPLTAITQLVHHGMIFVPIGYTFGAGMSEMEKVKGGSPYGAGTFAGDGSRQPSELELAQAFHQGKYFAGITKKLKGSA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Flavoprotein WrbA Seems to enhance the formation and/or stability of noncovalent complexes between the trp repressor protein and operator-bearing DNA.probableB7N3F9
Flavoprotein WrbA Seems to enhance the formation and/or stability of noncovalent complexes between the trp repressor protein and operator-bearing DNA.probableA9N6R4
Flavoprotein WrbA Seems to enhance the formation and/or stability of noncovalent complexes between the trp repressor protein and operator-bearing DNA.probableQ1CHD6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3B6I, chain A
Confidence level:very confident
Coverage over the Query: 13-150
View the alignment between query and template
View the model in PyMOL