BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 031829
         (152 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1F3D|L Chain L, Catalytic Antibody 4b2 In Complex With Its Amidinium
          Hapten.
 pdb|1F3D|J Chain J, Catalytic Antibody 4b2 In Complex With Its Amidinium
          Hapten
          Length = 219

 Score = 26.2 bits (56), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 20/33 (60%)

Query: 4  VPGALGSSASLALRFGQTIFSSGSILFMSFHVE 36
          +P +LG   S++ R  Q+IF S    ++ +H++
Sbjct: 11 LPVSLGDQVSISCRSSQSIFHSDGKTYLEWHLQ 43


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.330    0.137    0.433 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,902,618
Number of Sequences: 62578
Number of extensions: 127912
Number of successful extensions: 272
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 269
Number of HSP's gapped (non-prelim): 5
length of query: 152
length of database: 14,973,337
effective HSP length: 90
effective length of query: 62
effective length of database: 9,341,317
effective search space: 579161654
effective search space used: 579161654
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 47 (22.7 bits)