Citrus Sinensis ID: 031835

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--

MLRLGSKRLLRQATAAAVAAPRPVQVAAMPRLYHENVIDHYNNPRNVGSFEKNDATVGTGLVGAPACGDVMKLQIKVDEETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTGVAGKLQNIFLYHLLNCIAACLLKMLSRLL

ccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHccccHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHc

****************AVAAPRPVQVAAMPRLYHENVIDHYNNPRNVGSFEKNDATVGTGLVGAPACGDVMKLQIKVDEETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTGVAGKLQNIFLYHLLNCIAACLLKMLSRLL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLRLGSKRLLRQATAAAVAAPRPVQVAAMPRLYHENVIDHYNNPRNVGSFEKNDATVGTGLVGAPACGDVMKLQIKVDEETGQIVDACFKTFGCGSAIASSSVATEWVKGKQMQEVLSIKNTGVAGKLQNIFLYHLLNCIAACLLKMLSRLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
NifU-like protein	May be involved in the formation or repair of [Fe-S] clusters present in iron-sulfur proteins.	probable	P0ACD7
NifU-like protein	May be involved in the formation or repair of [Fe-S] clusters present in iron-sulfur proteins.	probable	P0ACD5
NifU-like protein	May be involved in the formation or repair of [Fe-S] clusters present in iron-sulfur proteins.	probable	Q89A18

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LVL, chain A
Confidence level:very confident
Coverage over the Query: 32-150
View the alignment between query and template
View the model in PyMOL