Citrus Sinensis ID: 031849

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MILDAISKLEEALMVSPNRHDTLWCLGNAHTSHAFLTPDQDEAKEYFNKATLYFQQAVDEEPSNELYQKSLEVAAKAPELHMEIHKHGLGQQTMGASTGPSSTSSGAKTSKKKKSSDLKYDIFGWVILAVGIVAWVGFAKSHMPPPPPTPPI
cHHHHHHHHHHHHHcccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccc
*ILDAISKLEEALMVSPNRHDTLWCLGNAHTSHAFLTPDQDEAKEYFNKATLYFQQAVDEEPSNELYQKSLEVAAKAPELHME***********************************KYDIFGWVILAVGIVAWVGFAK************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILDAISKLEEALMVSPNRHDTLWCLGNAHTSHAFLTPDQDEAKEYFNKATLYFQQAVDEEPSNELYQKSLEVAAKAPELHMEIHKHGLGQQTMGASTGPSSTSSGAKTSKKKKSSDLKYDIFGWVILAVGIVAWVGFAKSHMPPPPPTPPI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial import receptor subunit TOM20 Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the translocation pore.probableP92792
Mitochondrial import receptor subunit TOM20-3 Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the translocation pore.probableP82874
Probable mitochondrial import receptor subunit TOM20 Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the translocation pore.probableQ5JJI4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZU2, chain A
Confidence level:very confident
Coverage over the Query: 1-89
View the alignment between query and template
View the model in PyMOL