Citrus Sinensis ID: 031851


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MEQTFIMIKPDGVQRGLVGEIIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGILSMEVTQLRVPRKKSPCGSLMALLTGRAAFTLGSMSKLMFG
ccEEEEEEcccccccccHHHHHHHHHHHccEEEEEEcccccHHHHHHHHHHHcccccHHHHHHHHHcccEEEEEEEcccHHHHHHHHHccccccccccccccccccEEEccccHHHHHHHcccccccccccccccccccCEEEccccccccc
MEQTFIMIKPDGVQRGLVGEIIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGILSMEVTQLRVPRKKSPCGSLMALLTGRAAFTLGSMSKLMFG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEQTFIMIKPDGVQRGLVGEIIIRFEKKGFSLKGLKLMTVDRPFAEKHYEDLSSKPFFGSLIEYITSGPVVAMIWEGEGVVKTGRTIIGATNPAQSAPGTIRGDLAIVTGILSMEVTQLRVPRKKSPCGSLMALLTGRAAFTLGSMSKLMFG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nucleoside diphosphate kinase 1 Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.probableQ39839
Nucleoside diphosphate kinase Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.probableQ3M7K5
Nucleoside diphosphate kinase A Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.probableP47919

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.4.-2,7,4'-trihydroxyisoflavanone 4'-O-methyltransferase.probable
2.7.4.6Nucleoside-diphosphate kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U8W, chain A
Confidence level:very confident
Coverage over the Query: 1-132
View the alignment between query and template
View the model in PyMOL