Citrus Sinensis ID: 031863


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MAQFLDKAKNFVAEKMANIEKPEAEITDVDLKNVSREAVEYDAKVSVDNPYSHSLPICEISYTFKSAGKVIASGTMADPGSLKGNDKTLLQVPMKVPPNILVSLAKDIGADWDIDYEVELGLTIDLPIIGNFTIPLSKKGEFKLPSLSDIF
ccHHHHHHHHHHHHHHccccccCEEEEEEEEcccccccEEEEEEEEEEcccccccccccEEEEEEEccEEEEEECcccccEECcccCEEEEEEEEEcHHHHHHHHHHccccccCEEEEEEEEEEcccEEEEEEEEccCEEEECcccccccc
*******AKNFVAEKMANIEKPEAEITDVDLKNVSREAVEYDAKVSVDNPYSHSLPICEISYTFKSAGKVIASGT******LKGNDKTLLQVPMKVPPNILVSLAKDIGADWDIDYEVELGLTIDLPIIGNFTIPLSKKGEFKLPSLSDI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQFLDKAKNFVAEKMANIEKPEAEITDVDLKNVSREAVEYDAKVSVDNPYSHSLPICEISYTFKSAGKVIASGTMADPGSLKGNDKTLLQVPMKVPPNILVSLAKDIGADWDIDYEVELGLTIDLPIIGNFTIPLSKKGEFKLPSLSDIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Desiccation protectant protein Lea14 homolog confidentP46519
Probable desiccation-related protein LEA14 probableO03983
Late embryogenesis abundant protein Lea14-A probableP46518

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XO8, chain A
Confidence level:very confident
Coverage over the Query: 1-151
View the alignment between query and template
View the model in PyMOL