Citrus Sinensis ID: 031871


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-
MAGIGPITQDWEPVVIKKKAPNAATKKDEKVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLALLLSVLYCTDDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTKLERALGVKLRGKK
cccccccccccccEEEccccccccccccHHHHHHHHHcccccEEEEEcccccccccccccccccccccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHcccccccc
****GPI*QDWEPVV*********************************************************NLALLLSVLYCTDDRVPSELKKAIVQARNDKKLTQSQLAQLINEKPQVIQEYESGKAIPNQQILTKLERALGVKLRG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGIGPITQDWEPVVIKKKAPNAATKKDEKVVNAARRAGADIETVRKSHAGTNKAASSSTSLNTRKLDEDTENLALLLSVLYCTDDRVPSELKKAxxxxxxxxxxxxxxxxxxxxxKPQVIQEYESGKAIPNQQILTKLERALGVKLRGKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Multiprotein-bridging factor 1b Transcriptional coactivator that stimulates transcriptional activity by bridging regulatory proteins and TBP, thereby recruiting TBP to promoters occupied by DNA-binding regulators.confidentQ9LXT3
Endothelial differentiation-related factor 1 homolog Probable transcriptional coactivator.probableQ5ZMC0
Endothelial differentiation-related factor 1 Transcriptional coactivator stimulating NR5A1 and ligand-dependent NR1H3/LXRA and PPARG transcriptional activities. Enhances the DNA-binding activity of ATF1, ATF2, CREB1 and NR5A1. Regulates nitric oxid synthase activity probably by sequestering calmodulin in the cytoplasm. Might function in endothelial cells differentiation, hormone-induced cardiomyocytes hypertrophy and lipid metabolism.probableP69736

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JVL, chain A
Confidence level:very confident
Coverage over the Query: 59-150
View the alignment between query and template
View the model in PyMOL
Template: 3EUS, chain A
Confidence level:confident
Coverage over the Query: 30-68
View the alignment between query and template
View the model in PyMOL
Template: 4ICH, chain A
Confidence level:probable
Coverage over the Query: 84-129
View the alignment between query and template
View the model in PyMOL