Citrus Sinensis ID: 031874

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-

MDPRLCNVEEEVYEAHKNELEPTLAKRAEHYFTENRRVAKGLEAWKSGNSQDFGKLISASGLSSIYNYECGSEPLIQLNEILQRAPGVFGARFSGAGFRGCCLALVDADRAEEAASYVRSEYFELQPELASQLNADSAVLICKPGDCARVI

cccccccccHHHHHHHHccccHHHHHHHcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccccHHEEEEccccHHHHHHHHHHHHHHccHHHHHHccccccEEEEEcccccccc

MDPRLCNVEEEVYEAHKNELEPTLAKRAEHYFTENRRVAKGLEAWKSGNSQDFGKLISASGLSSIYNYECGSEPLIQLNEILQRAPGVFGARFSGAGFRGCCLALVDADRAEEAASYVRSEYFELQPELASQLNADSAVLICKPGDCARVI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MDPRLCNVEEEVYEAHKNELEPTLAKRAEHYFTENRRVAKGLEAWKSGNSQDFGKLISASGLSSIYNYECGSEPLIQLNEILQRAPGVFGARFSGAGFRGCCLALVDADRAEEAASYVRSEYFELQPELASQLNADSAVLICKPGDCARVI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Galacturonokinase	Sugar-1-kinase with a strict substrate specificity for the alpha-anomeric configuration of D-galacturonic acid (D-GalA) and ATP. Involved in the biosynthesis of UDP-galacturonic acid (UDP-GalA) from the salvaged GalA that is released during growth-dependent cell wall restructuring.	probable	Q8VYG2

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PIE, chain A
Confidence level:very confident
Coverage over the Query: 3-151
View the alignment between query and template
View the model in PyMOL