Citrus Sinensis ID: 031911


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MATVPGQLIWEIVKKNNCFLVKQFGRGNASVEFSKEPNNLYNLNSFKHSGLANRKTVTIQPGGKDLSVVLATAKTKKQNKPASLLHKSTMRKEFPRMAKAVVNQVADNYYRPDLKKAALARLSAVNRSLKVSKSGVKKRNRQATKVPVRK
ccccccccEEEEEEcccEEEEEEcccccccEEECccccccccccccccccccccCEEEEEEcccccEEEEEEEccccccccccCEEEEEEcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccccccccccccc
**TVPGQLIWEIVKKNNCFLVKQFGRGNASVEFSKEPNNLYNLNSFKHSGLANRKTVTIQPGGKDLSVVLATAKTKKQNKPASLL*************KAVVNQVADNYYRPDLKKAALARLSAV*************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATVPGQLIWEIVKKNNCFLVKQFGRGNASVEFSKEPNNLYNLNSFKHSGLANRKTVTIQPGGKDLSVVLATAKTKKQNKPASLLHKSTMRKEFPRMAKAVVNQVADNYYRPDLKKAALARLSAVNRSLKVSKSGVKKRNRQATKVPVRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L28-1 confidentO82204
60S ribosomal protein L28 probableQ9VZS5
60S ribosomal protein L28-2 probableQ9M0E2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A18, chain O
Confidence level:very confident
Coverage over the Query: 4-134
View the alignment between query and template
View the model in PyMOL
Template: 3IZR, chain b
Confidence level:very confident
Coverage over the Query: 57-128
View the alignment between query and template
View the model in PyMOL