BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 031916
(150 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1W7W|A Chain A, Structure And Mutational Analysis Of A Plant
Mitochondrial Nucleoside Diphosphate Kinase:
Identification Of Residues Involved In Serine
Phosphorylation And Oligomerization.
pdb|1W7W|B Chain B, Structure And Mutational Analysis Of A Plant
Mitochondrial Nucleoside Diphosphate Kinase:
Identification Of Residues Involved In Serine
Phosphorylation And Oligomerization.
pdb|1W7W|C Chain C, Structure And Mutational Analysis Of A Plant
Mitochondrial Nucleoside Diphosphate Kinase:
Identification Of Residues Involved In Serine
Phosphorylation And Oligomerization.
pdb|1W7W|D Chain D, Structure And Mutational Analysis Of A Plant
Mitochondrial Nucleoside Diphosphate Kinase:
Identification Of Residues Involved In Serine
Phosphorylation And Oligomerization.
pdb|1W7W|E Chain E, Structure And Mutational Analysis Of A Plant
Mitochondrial Nucleoside Diphosphate Kinase:
Identification Of Residues Involved In Serine
Phosphorylation And Oligomerization.
pdb|1W7W|F Chain F, Structure And Mutational Analysis Of A Plant
Mitochondrial Nucleoside Diphosphate Kinase:
Identification Of Residues Involved In Serine
Phosphorylation And Oligomerization
Length = 182
Score = 29.6 bits (65), Expect = 0.61, Method: Compositional matrix adjust.
Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%)
Query: 4 SSYPNQKFDHQHVATGVPVAGFQQQHANVHQLVEGPWSSGLCDCFS 49
S + + F + +P F QQH H L E P+ +GLCD S
Sbjct: 54 SRFERKGFKLVGIKVLIPTKQFAQQH--YHDLKERPFFNGLCDFLS 97
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.136 0.446
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,200,927
Number of Sequences: 62578
Number of extensions: 139208
Number of successful extensions: 288
Number of sequences better than 100.0: 10
Number of HSP's better than 100.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 279
Number of HSP's gapped (non-prelim): 10
length of query: 150
length of database: 14,973,337
effective HSP length: 90
effective length of query: 60
effective length of database: 9,341,317
effective search space: 560479020
effective search space used: 560479020
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 47 (22.7 bits)