Query         031938
Match_columns 150
No_of_seqs    162 out of 692
Neff          5.3 
Searched_HMMs 46136
Date          Fri Mar 29 07:25:42 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/031938.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/031938hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1591 Prolyl 4-hydroxylase a  99.9 5.7E-23 1.2E-27  173.8   5.4   97   49-149    49-158 (289)
  2 PLN00052 prolyl 4-hydroxylase;  99.7 1.8E-17 3.8E-22  141.5   6.9   74   74-149    41-114 (310)
  3 smart00702 P4Hc Prolyl 4-hydro  98.7 1.1E-08 2.3E-13   79.0   4.6   61   87-148     1-61  (178)
  4 PRK05467 Fe(II)-dependent oxyg  69.7     4.2   9E-05   33.7   2.6   22   89-110     2-23  (226)
  5 PHA02708 hypothetical protein;  56.2      12 0.00026   29.0   2.8   29    5-33      2-37  (148)
  6 PF07894 DUF1669:  Protein of u  47.9      24 0.00053   30.4   3.7   19   92-110    47-65  (284)
  7 PF01448 ELM2:  ELM2 domain;  I  44.7      24 0.00052   22.3   2.5   27   80-111    28-54  (55)
  8 PF06624 RAMP4:  Ribosome assoc  39.4      16 0.00035   24.6   1.1   22    5-29     36-57  (63)
  9 PF13532 2OG-FeII_Oxy_2:  2OG-F  37.0      37  0.0008   25.9   2.9   21   89-109     2-22  (194)
 10 PF02529 PetG:  Cytochrome B6-F  37.0      69  0.0015   19.6   3.4   23    7-29      7-29  (37)
 11 PF06364 DUF1068:  Protein of u  32.9      66  0.0014   25.9   3.7   31    7-37      8-38  (176)
 12 cd08434 PBP2_GltC_like The sub  32.7      74  0.0016   22.3   3.7   43   53-95     65-107 (195)
 13 PF06522 B12D:  NADH-ubiquinone  32.2      38 0.00081   23.0   2.0   17   10-26      6-22  (73)
 14 PF05721 PhyH:  Phytanoyl-CoA d  29.5      63  0.0014   23.8   3.0   21   90-110     7-27  (211)
 15 PF14089 KbaA:  KinB-signalling  29.4      92   0.002   25.2   4.0   29    7-35     27-55  (180)
 16 KOG3491 Predicted membrane pro  29.2      81  0.0018   21.3   3.1   23    4-29     35-57  (65)
 17 PF07811 TadE:  TadE-like prote  26.5 1.3E+02  0.0028   17.5   3.5   21    9-29      9-29  (43)
 18 smart00806 AIP3 Actin interact  26.5      53  0.0011   29.9   2.4   25   25-49     20-45  (426)
 19 cd08437 PBP2_MleR The substrat  24.2      90  0.0019   22.2   2.9   51   54-104    68-118 (198)
 20 KOG3200 Uncharacterized conser  23.4      97  0.0021   25.5   3.2   27   82-108     7-33  (224)
 21 PF12646 DUF3783:  Domain of un  22.3 1.2E+02  0.0026   19.5   2.9   24   87-111     1-24  (58)
 22 cd08425 PBP2_CynR The C-termin  21.5      92   0.002   22.1   2.5   51   54-104    67-118 (197)
 23 cd08788 CARD_NOD2_2_CARD15 Cas  21.0      40 0.00087   24.0   0.5   15   92-106    25-39  (81)
 24 PF11303 DUF3105:  Protein of u  20.9 2.5E+02  0.0055   21.2   4.9   29   86-114    50-78  (130)
 25 PRK11677 hypothetical protein;  20.2 1.1E+02  0.0023   23.6   2.7   18    9-27      3-20  (134)

No 1  
>KOG1591 consensus Prolyl 4-hydroxylase alpha subunit [Amino acid transport and metabolism]
Probab=99.87  E-value=5.7e-23  Score=173.78  Aligned_cols=97  Identities=44%  Similarity=0.656  Sum_probs=83.7

Q ss_pred             hccccccCCCCCce------------EEcCCCCCceEEecccceEEeccCCcEEEEcccCCHHHHHHHHHHhccCceeeE
Q 031938           49 RQKNGYLQLPRGVT------------FWDNDKEAELLRLGYVKPEVISWSPRILVLHNFLSMEECDYLRAIARPHLQVST  116 (150)
Q Consensus        49 ~~~~~y~~lCrG~~------------c~y~~~~~pfL~l~P~K~E~ls~~P~IvlyhnflS~~E~~~Li~lakp~L~rS~  116 (150)
                      .....|+..|||+.            |++. .+ ||++++|+|+|+|||+|++++||||||++||++|+++|+|+|++++
T Consensus        49 ~~~~~~~~~c~g~~~~~~~~~~~~~~~~~~-~~-~~~~~ap~k~E~lsw~P~~~~yhd~ls~~e~d~l~~lak~~l~~st  126 (289)
T KOG1591|consen   49 QEFTVYEQGCRGELPPLTKLTLRRLSCRNR-AG-PFLRLAPVKLEELSWDPRVVLYHDFLSDEECDHLISLAKPKLERST  126 (289)
T ss_pred             ccccchhhhccCccCccchhHhhhhhcccc-cC-cceeecchhhhhcccCCceEeehhcCCHHHHHHHHHhhhhhhhcee
Confidence            56778999999952            4332 22 9999999999999999999999999999999999999999999999


Q ss_pred             ee-ecCCCCceecceeeeeccccCCCCCCCCccc
Q 031938          117 VV-DTKTGKGIKSNVRTSSGMFLSPEEKKYPMIQ  149 (150)
Q Consensus       117 V~-d~~tG~~~~s~~RtS~~awL~~~e~~~pvV~  149 (150)
                      |+ +..+|....+.+|+|+++|+..++  +++++
T Consensus       127 v~~~~~~~~~~~~~~R~S~~t~l~~~~--~~~~~  158 (289)
T KOG1591|consen  127 VVADKGTGHSTTSAVRTSSGTFLPDGA--SPVVS  158 (289)
T ss_pred             eeccCCcccccceeeEecceeEecCCC--CHHHH
Confidence            95 666688778889999999999854  77764


No 2  
>PLN00052 prolyl 4-hydroxylase; Provisional
Probab=99.70  E-value=1.8e-17  Score=141.54  Aligned_cols=74  Identities=43%  Similarity=0.731  Sum_probs=68.0

Q ss_pred             EecccceEEeccCCcEEEEcccCCHHHHHHHHHHhccCceeeEeeecCCCCceecceeeeeccccCCCCCCCCccc
Q 031938           74 RLGYVKPEVISWSPRILVLHNFLSMEECDYLRAIARPHLQVSTVVDTKTGKGIKSNVRTSSGMFLSPEEKKYPMIQ  149 (150)
Q Consensus        74 ~l~P~K~E~ls~~P~IvlyhnflS~~E~~~Li~lakp~L~rS~V~d~~tG~~~~s~~RtS~~awL~~~e~~~pvV~  149 (150)
                      .+.|.|+|+|||+|+|++||||||++||++||++|+++|++|+|++..+|+...+++|||+++||.+.+  +|+++
T Consensus        41 ~~~~~kve~lS~~P~i~~~~nfLs~~Ecd~Li~la~~~l~~S~v~~~~~g~~~~s~~RTS~~~~l~~~~--dpvv~  114 (310)
T PLN00052         41 PFNASRVKAVSWQPRIFVYKGFLSDAECDHLVKLAKKKIQRSMVADNKSGKSVMSEVRTSSGMFLDKRQ--DPVVS  114 (310)
T ss_pred             CcCCceEEEecCCCCEEEECCcCCHHHHHHHHHhcccccccceeecCCCCccccCCCEEecceeecCCC--CHHHH
Confidence            348999999999999999999999999999999999999999999887888788899999999998776  78764


No 3  
>smart00702 P4Hc Prolyl 4-hydroxylase alpha subunit homologues. Mammalian enzymes catalyse hydroxylation of collagen, for example. Prokaryotic enzymes might catalyse hydroxylation of antibiotic peptides. These are 2-oxoglutarate-dependent dioxygenases, requiring 2-oxoglutarate and dioxygen as cosubstrates and ferrous iron as a cofactor.
Probab=98.74  E-value=1.1e-08  Score=79.05  Aligned_cols=61  Identities=31%  Similarity=0.390  Sum_probs=50.5

Q ss_pred             CcEEEEcccCCHHHHHHHHHHhccCceeeEeeecCCCCceecceeeeeccccCCCCCCCCcc
Q 031938           87 PRILVLHNFLSMEECDYLRAIARPHLQVSTVVDTKTGKGIKSNVRTSSGMFLSPEEKKYPMI  148 (150)
Q Consensus        87 P~IvlyhnflS~~E~~~Li~lakp~L~rS~V~d~~tG~~~~s~~RtS~~awL~~~e~~~pvV  148 (150)
                      |.|++||||||++||+.|++++++.+.++.+.+...+....+++|+|+.+|+..++ .+|++
T Consensus         1 P~i~~~~~~ls~~ec~~li~~~~~~~~~~~~~~~~~~~~~~~~~R~~~~~~l~~~~-~~~~~   61 (178)
T smart00702        1 PGVVVFHDFLSPAECQKLLEEAEPLGWRGEVTRGDTNPNHDSKYRQSNGTWLELLK-GDLVI   61 (178)
T ss_pred             CcEEEECCCCCHHHHHHHHHHhhhhcccceeecCCCCccccCCCEeecceecCCCC-CCHHH
Confidence            88999999999999999999999999999998665443356789999999998763 24543


No 4  
>PRK05467 Fe(II)-dependent oxygenase superfamily protein; Provisional
Probab=69.72  E-value=4.2  Score=33.67  Aligned_cols=22  Identities=27%  Similarity=0.409  Sum_probs=19.4

Q ss_pred             EEEEcccCCHHHHHHHHHHhcc
Q 031938           89 ILVLHNFLSMEECDYLRAIARP  110 (150)
Q Consensus        89 IvlyhnflS~~E~~~Li~lakp  110 (150)
                      |...+||||++||+++++....
T Consensus         2 i~~I~~vLs~eec~~~~~~le~   23 (226)
T PRK05467          2 LLHIPDVLSPEEVAQIRELLDA   23 (226)
T ss_pred             eeeecccCCHHHHHHHHHHHHh
Confidence            6789999999999999998753


No 5  
>PHA02708 hypothetical protein; Provisional
Probab=56.18  E-value=12  Score=29.03  Aligned_cols=29  Identities=41%  Similarity=0.818  Sum_probs=24.7

Q ss_pred             cchHHHHHHHHHHHHHHHHHHHH-------HHHHHH
Q 031938            5 PSMKIVFGLLTFVTFGMIIGALF-------QLAFIR   33 (150)
Q Consensus         5 ~~~~~~~~~~~~~~~~m~~~~~~-------q~~f~~   33 (150)
                      |+.|.+++-+.||.+|...|+++       -+||++
T Consensus         2 pslRRLl~alalvalgfalgalfrpaap~lPaA~~E   37 (148)
T PHA02708          2 PSLRRLLAALALVALGFALGALFRPAAPALPAAFIE   37 (148)
T ss_pred             ccHHHHHHHHHHHHHHHHHhhhcCCCCcCcchHHhc
Confidence            67899999999999999999985       466664


No 6  
>PF07894 DUF1669:  Protein of unknown function (DUF1669);  InterPro: IPR012461 This family is composed of sequences derived from hypothetical eukaryotic proteins of unknown function. Some members of this family are annotated as being potential phospholipases but no literature was found to support this. 
Probab=47.95  E-value=24  Score=30.37  Aligned_cols=19  Identities=37%  Similarity=0.466  Sum_probs=17.0

Q ss_pred             EcccCCHHHHHHHHHHhcc
Q 031938           92 LHNFLSMEECDYLRAIARP  110 (150)
Q Consensus        92 yhnflS~~E~~~Li~lakp  110 (150)
                      ..+|||+.|++.|.+-++.
T Consensus        47 ~~~FLS~~Ei~~I~~~~~~   65 (284)
T PF07894_consen   47 ERDFLSSEEIQYILENAED   65 (284)
T ss_pred             CCCCCCHHHHHHHHHhccC
Confidence            4799999999999999974


No 7  
>PF01448 ELM2:  ELM2 domain;  InterPro: IPR000949 The ELM2 (Egl-27 and MTA1 homology 2) domain is a small domain of unknown function. It is found in the MTA1 protein that is part of the NuRD complex []. The domain is usually found to the N terminus of a myb-like DNA binding domain and a GATA binding domain. ELM2, in some instances, is also found associated with the ARID DNA binding domain IPR001606 from INTERPRO. This suggests that ELM2 may also be involved in DNA binding, or perhaps is a protein-protein interaction domain.
Probab=44.72  E-value=24  Score=22.27  Aligned_cols=27  Identities=30%  Similarity=0.461  Sum_probs=22.1

Q ss_pred             eEEeccCCcEEEEcccCCHHHHHHHHHHhccC
Q 031938           80 PEVISWSPRILVLHNFLSMEECDYLRAIARPH  111 (150)
Q Consensus        80 ~E~ls~~P~IvlyhnflS~~E~~~Li~lakp~  111 (150)
                      -|++-|+|     ++.+++.+++.++.+|+.+
T Consensus        28 ~e~lvW~P-----~~~~~d~~l~~yl~~A~s~   54 (55)
T PF01448_consen   28 EEELVWSP-----NNPLSDRKLEEYLKVAKSS   54 (55)
T ss_pred             cceEeECC-----CCCCCHHHHHHHHHHHHhc
Confidence            45667899     4899999999999998753


No 8  
>PF06624 RAMP4:  Ribosome associated membrane protein RAMP4;  InterPro: IPR010580 This entry contains Serp1/Ramp4, which has been shown to interacts with target proteins during their translocation into the lumen of the endoplasmic reticulum. It has also been shown to protect unfolded target proteins against degradation during ER stress. It may facilitate glycosylation of target proteins after termination of ER stress and may modulate the use of N-glycosylation sites on target proteins [, ].
Probab=39.45  E-value=16  Score=24.61  Aligned_cols=22  Identities=41%  Similarity=0.769  Sum_probs=16.6

Q ss_pred             cchHHHHHHHHHHHHHHHHHHHHHH
Q 031938            5 PSMKIVFGLLTFVTFGMIIGALFQL   29 (150)
Q Consensus         5 ~~~~~~~~~~~~~~~~m~~~~~~q~   29 (150)
                      |--.+++||+.||-+|   ++++|+
T Consensus        36 pVgp~~L~l~iFVV~G---s~ifqi   57 (63)
T PF06624_consen   36 PVGPWLLGLFIFVVCG---SAIFQI   57 (63)
T ss_pred             CcCHHHHhhhheeeEc---HHHHHH
Confidence            4557889999999887   456665


No 9  
>PF13532 2OG-FeII_Oxy_2:  2OG-Fe(II) oxygenase superfamily; PDB: 2IUW_A 3BTZ_A 3RZL_A 3RZH_A 3S5A_A 3RZG_A 3RZJ_A 3BUC_A 3H8X_A 3H8R_A ....
Probab=37.00  E-value=37  Score=25.87  Aligned_cols=21  Identities=38%  Similarity=0.404  Sum_probs=17.6

Q ss_pred             EEEEcccCCHHHHHHHHHHhc
Q 031938           89 ILVLHNFLSMEECDYLRAIAR  109 (150)
Q Consensus        89 IvlyhnflS~~E~~~Li~lak  109 (150)
                      +.+++||||++|.+.|.+...
T Consensus         2 ~~~~~~fls~~e~~~l~~~l~   22 (194)
T PF13532_consen    2 LYYIPNFLSEEEAAELLNELR   22 (194)
T ss_dssp             EEEETTSS-HHHHHHHHHHHH
T ss_pred             EEEECCCCCHHHHHHHHHHHH
Confidence            468999999999999988876


No 10 
>PF02529 PetG:  Cytochrome B6-F complex subunit 5;  InterPro: IPR003683 This family consists of cytochrome b6/f complex subunit 5 (PetG). The cytochrome bf complex, found in green plants, eukaryotic algae and cyanobacteria, connects photosystem I to photosystem II in the electron transport chain, functioning as a plastoquinol:plastocyanin/cytochrome c6 oxidoreductase []. The purified complex from the unicellular alga Chlamydomonas reinhardtii contains seven subunits; namely four high molecular weight subunits (cytochrome f, Rieske iron-sulphur protein, cytochrome b6, and subunit IV) and three approximately miniproteins (PetG, PetL, and PetX) []. Stoichiometry measurements are consistent with every subunit being present as two copies per b6/f dimer. The absence of PetG affects either the assembly or stability of the cytochrome bf complex in C. reinhardtii [].; GO: 0009512 cytochrome b6f complex; PDB: 1Q90_G 2ZT9_G 1VF5_G 2D2C_G 2E74_G 2E75_G 2E76_G.
Probab=36.99  E-value=69  Score=19.57  Aligned_cols=23  Identities=30%  Similarity=0.551  Sum_probs=19.8

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHH
Q 031938            7 MKIVFGLLTFVTFGMIIGALFQL   29 (150)
Q Consensus         7 ~~~~~~~~~~~~~~m~~~~~~q~   29 (150)
                      .-||+||+...-+|-...|.+|.
T Consensus         7 ~GiVlGli~vtl~Glfv~Ay~QY   29 (37)
T PF02529_consen    7 SGIVLGLIPVTLAGLFVAAYLQY   29 (37)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             hhHHHHhHHHHHHHHHHHHHHHH
Confidence            46899999988889988888886


No 11 
>PF06364 DUF1068:  Protein of unknown function (DUF1068);  InterPro: IPR010471 This family consists of several hypothetical plant proteins from Arabidopsis thaliana and Oryza sativa. The function of this family is unknown.
Probab=32.90  E-value=66  Score=25.95  Aligned_cols=31  Identities=23%  Similarity=0.408  Sum_probs=27.3

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHhhcc
Q 031938            7 MKIVFGLLTFVTFGMIIGALFQLAFIRKLED   37 (150)
Q Consensus         7 ~~~~~~~~~~~~~~m~~~~~~q~~f~~~~~~   37 (150)
                      .|.+++|+++..+|-|.||.+=--|.+.+..
T Consensus         8 lr~~l~llal~~a~yivGP~LYWh~~~~~~~   38 (176)
T PF06364_consen    8 LRVVLVLLALCLAGYIVGPPLYWHLSEGLAA   38 (176)
T ss_pred             HHHHHHHHHHHHHhheeCchHHHHHHHhhhc
Confidence            7999999999999999999998877777654


No 12 
>cd08434 PBP2_GltC_like The substrate binding domain of LysR-type transcriptional regulator GltC, which activates gltA expression of glutamate synthase operon, contains type 2 periplasmic binding fold. GltC, a member of the LysR family of bacterial transcriptional factors, activates the expression of gltA gene of glutamate synthase operon and is essential for cell growth in the absence of glutamate. Glutamate synthase is a heterodimeric protein that encoded by gltA and gltB, whose expression is subject to nutritional regulation. GltC also negatively auto-regulates its own expression. This substrate-binding domain has strong homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, 
Probab=32.74  E-value=74  Score=22.26  Aligned_cols=43  Identities=16%  Similarity=0.111  Sum_probs=30.9

Q ss_pred             cccCCCCCceEEcCCCCCceEEecccceEEeccCCcEEEEccc
Q 031938           53 GYLQLPRGVTFWDNDKEAELLRLGYVKPEVISWSPRILVLHNF   95 (150)
Q Consensus        53 ~y~~lCrG~~c~y~~~~~pfL~l~P~K~E~ls~~P~Ivlyhnf   95 (150)
                      .++.+|+...|.+-..++|.....++..+++...|.|..-.+.
T Consensus        65 ~~~~l~~~~~~~v~~~~~~l~~~~~~~~~~l~~~~~i~~~~~~  107 (195)
T cd08434          65 EWIPLFTEELVLVVPKDHPLAGRDSVDLAELADEPFVLLSPGF  107 (195)
T ss_pred             eEEEeecceEEEEecCCCccccCCccCHHHhcCCceEEecCCc
Confidence            3455677667777677788766667888899989998764443


No 13 
>PF06522 B12D:  NADH-ubiquinone reductase complex 1 MLRQ subunit;  InterPro: IPR010530 The MLRQ subunit of mitochondrial NADH-ubiquinone reductase complex I is nuclear [] and is found in plants [], insects, fungi and higher metazoans []. It appears to act within the membrane and, in mammals, is highly expressed in muscle and neural tissue, indicative of a role in ATP generation [].
Probab=32.17  E-value=38  Score=23.05  Aligned_cols=17  Identities=12%  Similarity=0.215  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 031938           10 VFGLLTFVTFGMIIGAL   26 (150)
Q Consensus        10 ~~~~~~~~~~~m~~~~~   26 (150)
                      |++|+.+|++|+..++.
T Consensus         6 l~PL~~~vg~a~~~a~~   22 (73)
T PF06522_consen    6 LYPLFVIVGVAVGGATF   22 (73)
T ss_pred             ccchHHHHHHHHHHHHH
Confidence            78899999988766554


No 14 
>PF05721 PhyH:  Phytanoyl-CoA dioxygenase (PhyH);  InterPro: IPR008775 This family is made up of several eukaryotic phytanoyl-CoA dioxygenase (PhyH) proteins as well as a number of bacterial deoxygenases. PhyH is a peroxisomal enzyme catalysing the first step of phytanic acid alpha-oxidation. PhyH deficiency causes Refsum's disease (RD) which is an inherited neurological syndrome biochemically characterised by the accumulation of phytanic acid in plasma and tissues [].; PDB: 3GJA_A 3EMR_A 3OBZ_A 2OPW_A 3NNL_B 3NNF_A 3NNM_B 3NNJ_A 2FCV_B 2FCU_A ....
Probab=29.52  E-value=63  Score=23.77  Aligned_cols=21  Identities=38%  Similarity=0.445  Sum_probs=17.1

Q ss_pred             EEEcccCCHHHHHHHHHHhcc
Q 031938           90 LVLHNFLSMEECDYLRAIARP  110 (150)
Q Consensus        90 vlyhnflS~~E~~~Li~lakp  110 (150)
                      +++.|+++++|++.|++....
T Consensus         7 vvi~~~l~~~~~~~l~~~~~~   27 (211)
T PF05721_consen    7 VVIRNVLSPEEVERLREELDR   27 (211)
T ss_dssp             EEETTSS-HHHHHHHHHHHHH
T ss_pred             EEECCcCCHHHHHHHHHHHHH
Confidence            678999999999999887754


No 15 
>PF14089 KbaA:  KinB-signalling pathway activation in sporulation
Probab=29.38  E-value=92  Score=25.25  Aligned_cols=29  Identities=24%  Similarity=0.447  Sum_probs=25.1

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Q 031938            7 MKIVFGLLTFVTFGMIIGALFQLAFIRKL   35 (150)
Q Consensus         7 ~~~~~~~~~~~~~~m~~~~~~q~~f~~~~   35 (150)
                      +.++.+++.+..+||+....||.-|.-=|
T Consensus        27 ~e~~~~~~~~~~~G~~~SviSQMGFFAYL   55 (180)
T PF14089_consen   27 GEILAGLFWLIGVGFTFSVISQMGFFAYL   55 (180)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            56888999999999999999999886443


No 16 
>KOG3491 consensus Predicted membrane protein [Function unknown]
Probab=29.19  E-value=81  Score=21.35  Aligned_cols=23  Identities=43%  Similarity=0.704  Sum_probs=17.3

Q ss_pred             CcchHHHHHHHHHHHHHHHHHHHHHH
Q 031938            4 APSMKIVFGLLTFVTFGMIIGALFQL   29 (150)
Q Consensus         4 ~~~~~~~~~~~~~~~~~m~~~~~~q~   29 (150)
                      .|..-+++||..||..|-   |++|.
T Consensus        35 ypvgPwLlglFvFVVcGS---a~FqI   57 (65)
T KOG3491|consen   35 YPVGPWLLGLFVFVVCGS---ALFQI   57 (65)
T ss_pred             CCcchHHHHHHHHHhhcH---HHHHH
Confidence            366678999999998885   55554


No 17 
>PF07811 TadE:  TadE-like protein;  InterPro: IPR012495 The members of this family are similar to a region of the protein product of the bacterial tadE locus (Q9S4A6 from SWISSPROT). In various bacterial species, the tad locus is closely linked to flp-like genes, which encode proteins required for the production of pili involved in adherence to surfaces []. It is thought that the tad loci encode proteins that act to assemble or export an Flp pilus in various bacteria []. All tad loci but TadA have putative transmembrane regions [], and in fact the region in question is this family has a high proportion of hydrophobic amino acid residues. 
Probab=26.47  E-value=1.3e+02  Score=17.49  Aligned_cols=21  Identities=19%  Similarity=0.366  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHH
Q 031938            9 IVFGLLTFVTFGMIIGALFQL   29 (150)
Q Consensus         9 ~~~~~~~~~~~~m~~~~~~q~   29 (150)
                      +++|++.++.+|+++......
T Consensus         9 lv~Pvl~~~~~~~~~~~~~~~   29 (43)
T PF07811_consen    9 LVLPVLLLLLFGIVELGRMFY   29 (43)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            577778788888777765544


No 18 
>smart00806 AIP3 Actin interacting protein 3. Aip3p/Bud6p is a regulator of cell and cytoskeletal polarity in Saccharomyces cerevisiae that was previously identified as an actin-interacting protein. Actin-interacting protein 3 (Aip3p) localizes at the cell cortex where cytoskeleton assembly must be achieved to execute polarized cell growth, and deletion of AIP3 causes gross defects in cell and cytoskeletal polarity. Aip3p localization is mediated by the secretory pathway, mutations in early- or late-acting components of the secretory apparatus lead to Aip3p mislocalization PUBMED:10679021.
Probab=26.45  E-value=53  Score=29.94  Aligned_cols=25  Identities=36%  Similarity=0.572  Sum_probs=19.2

Q ss_pred             HHHHHHHHHhhccCcCC-CCcchhhh
Q 031938           25 ALFQLAFIRKLEDSYGT-DFPSFMRR   49 (150)
Q Consensus        25 ~~~q~~f~~~~~~~~~~-~~~~~~~~   49 (150)
                      +-+||+|+++..|++|+ |||+.-=.
T Consensus        20 ~~LrLlFvekFayspg~~~fPeIYIq   45 (426)
T smart00806       20 NALRLLFIEKFAYSPGGDDFPDIYIQ   45 (426)
T ss_pred             HHHHHHHHHHhccCCCCCCCcceecc
Confidence            45899999999999654 67775444


No 19 
>cd08437 PBP2_MleR The substrate binding domain of LysR-type transcriptional regulator MleR which required for malolactic fermentation, contains type 2 periplasmic binidning fold. MleR, a transcription activator of malolactic fermentation system, is found in gram-positive bacteria and belongs to the lysR family of bacterial transcriptional regulators. The mleR gene is required for the expression and induction of malolactic fermentation. This substrate binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase dom
Probab=24.16  E-value=90  Score=22.25  Aligned_cols=51  Identities=16%  Similarity=0.040  Sum_probs=31.4

Q ss_pred             ccCCCCCceEEcCCCCCceEEecccceEEeccCCcEEEEcccCCHHHHHHH
Q 031938           54 YLQLPRGVTFWDNDKEAELLRLGYVKPEVISWSPRILVLHNFLSMEECDYL  104 (150)
Q Consensus        54 y~~lCrG~~c~y~~~~~pfL~l~P~K~E~ls~~P~IvlyhnflS~~E~~~L  104 (150)
                      ++.++....|.+-..++|+....++..+++...|.|..-.+.-....++.+
T Consensus        68 ~~~l~~~~~~~~~~~~hpl~~~~~i~~~dL~~~~~i~~~~~~~~~~~~~~~  118 (198)
T cd08437          68 SKIIKTQHFMIIVSKDHPLAKAKKVNFADLKKENFILLNEHFVHPKAFDSL  118 (198)
T ss_pred             EEEeecceEEEEecCCCcccccCcccHHHHcCCCeEEecccchHHHHHHHH
Confidence            344555555555566777766667888889999998764433223344433


No 20 
>KOG3200 consensus Uncharacterized conserved protein [Function unknown]
Probab=23.37  E-value=97  Score=25.53  Aligned_cols=27  Identities=19%  Similarity=0.406  Sum_probs=22.2

Q ss_pred             EeccCCcEEEEcccCCHHHHHHHHHHh
Q 031938           82 VISWSPRILVLHNFLSMEECDYLRAIA  108 (150)
Q Consensus        82 ~ls~~P~IvlyhnflS~~E~~~Li~la  108 (150)
                      ++-..|.++...|||++||-..++...
T Consensus         7 ~V~~~pt~~YIPnfIt~EEe~~~lshI   33 (224)
T KOG3200|consen    7 IVKSAPTMIYIPNFITEEEENLYLSHI   33 (224)
T ss_pred             EecccceEEEcCCccChHHHHHHHHHH
Confidence            455678899999999999998887655


No 21 
>PF12646 DUF3783:  Domain of unknown function (DUF3783);  InterPro: IPR016621 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=22.31  E-value=1.2e+02  Score=19.53  Aligned_cols=24  Identities=29%  Similarity=0.330  Sum_probs=19.5

Q ss_pred             CcEEEEcccCCHHHHHHHHHHhccC
Q 031938           87 PRILVLHNFLSMEECDYLRAIARPH  111 (150)
Q Consensus        87 P~IvlyhnflS~~E~~~Li~lakp~  111 (150)
                      |.+++|++| +++|++.++...|..
T Consensus         1 e~~ll~~g~-~~~el~~~l~~~r~~   24 (58)
T PF12646_consen    1 EEFLLFSGF-SGEELDKFLDALRKA   24 (58)
T ss_pred             CCEEEECCC-CHHHHHHHHHHHHHc
Confidence            457789988 899999999888654


No 22 
>cd08425 PBP2_CynR The C-terminal substrate-binding domain of the LysR-type transcriptional regulator CynR, contains the type 2 periplasmic binding fold. CynR is a LysR-like transcriptional regulator of the cyn operon, which encodes genes that allow cyanate to be used as a sole source of nitrogen. The operon includes three genes in the following order: cynT (cyanate permease), cynS (cyanase), and cynX (a protein of unknown function).  CynR negatively regulates its own expression independently of cyanate. CynR binds to DNA and induces bending of DNA in the presence or absence of cyanate, but the amount of bending is decreased by cyanate. The CynR of LysR-type transcriptional regulator family is composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding 
Probab=21.53  E-value=92  Score=22.10  Aligned_cols=51  Identities=12%  Similarity=0.001  Sum_probs=32.5

Q ss_pred             ccCCCCCceEEcCCCCCceEEec-ccceEEeccCCcEEEEcccCCHHHHHHH
Q 031938           54 YLQLPRGVTFWDNDKEAELLRLG-YVKPEVISWSPRILVLHNFLSMEECDYL  104 (150)
Q Consensus        54 y~~lCrG~~c~y~~~~~pfL~l~-P~K~E~ls~~P~IvlyhnflS~~E~~~L  104 (150)
                      ++.+|....|.+-..++|+.... ++..++|...|+|..-.+.......+..
T Consensus        67 ~~~l~~~~~~~v~~~~~pl~~~~~~~~~~dL~~~~~i~~~~~~~~~~~~~~~  118 (197)
T cd08425          67 AQPLFDERLALVVGATHPLAQRRTALTLDDLAAEPLALLSPDFATRQHIDRY  118 (197)
T ss_pred             EEEeccccEEEEecCCCchhHhcccCCHHHHhcCCcEecCCCccHHHHHHHH
Confidence            34455555566656677766543 5788889999999876665544444433


No 23 
>cd08788 CARD_NOD2_2_CARD15 Caspase activation and recruitment domain of NOD2, repeat 2. Caspase activation and recruitment domain (CARD) similar to that found in human NOD2 (CARD15), repeat 2. NOD2 is a member of the Nod-like receptor (NLR) family, which plays a central role in the innate immune response. NLRs typically contain an N-terminal effector domain, a central nucleotide-binding domain and a C-terminal ligand-binding region of several leucine-rich repeats (LRRs). In NOD2, as well as NOD1, the N-terminal effector domain is a CARD. NOD2 contains two N-terminal CARD repeats. Mutations in NOD2 have been associated with Crohns disease and Blau syndrome. Nod2-CARDs have been shown to interact with the CARD domain of the downstream effector RICK (RIP2, CARDIAK), a serine/threonine kinase. In general, CARDs are death domains (DDs) found associated with caspases. They are known to be important in the signaling pathways for apoptosis, inflammation, and host-defense mechanisms. DDs are pr
Probab=21.02  E-value=40  Score=23.98  Aligned_cols=15  Identities=33%  Similarity=0.651  Sum_probs=12.3

Q ss_pred             EcccCCHHHHHHHHH
Q 031938           92 LHNFLSMEECDYLRA  106 (150)
Q Consensus        92 yhnflS~~E~~~Li~  106 (150)
                      =+++||++||+.+..
T Consensus        25 ~~G~is~~Ecd~Ir~   39 (81)
T cd08788          25 TRGFFSSYDCDEIRL   39 (81)
T ss_pred             HcCCccHhhcchhhc
Confidence            478899999998875


No 24 
>PF11303 DUF3105:  Protein of unknown function (DUF3105);  InterPro: IPR021454  Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently no function is known. 
Probab=20.90  E-value=2.5e+02  Score=21.18  Aligned_cols=29  Identities=17%  Similarity=0.245  Sum_probs=24.0

Q ss_pred             CCcEEEEcccCCHHHHHHHHHHhccCcee
Q 031938           86 SPRILVLHNFLSMEECDYLRAIARPHLQV  114 (150)
Q Consensus        86 ~P~IvlyhnflS~~E~~~Li~lakp~L~r  114 (150)
                      =--++.||-=++++|.+.|+++++.-..+
T Consensus        50 GaV~i~Y~p~~~~~~v~~L~~l~~~~~~~   78 (130)
T PF11303_consen   50 GAVWITYDPCLPPDQVAKLKALAKSCLPY   78 (130)
T ss_pred             CcEEEEECCCCCHHHHHHHHHHHhccCCc
Confidence            35678899999999999999999875543


No 25 
>PRK11677 hypothetical protein; Provisional
Probab=20.22  E-value=1.1e+02  Score=23.56  Aligned_cols=18  Identities=39%  Similarity=0.717  Sum_probs=9.5

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 031938            9 IVFGLLTFVTFGMIIGALF   27 (150)
Q Consensus         9 ~~~~~~~~~~~~m~~~~~~   27 (150)
                      +++++++|| +|.|+|.+.
T Consensus         3 W~~a~i~li-vG~iiG~~~   20 (134)
T PRK11677          3 WEYALIGLV-VGIIIGAVA   20 (134)
T ss_pred             HHHHHHHHH-HHHHHHHHH
Confidence            445554444 566666543


Done!